KEGG   Empidonax traillii (willow flycatcher): 114057504
Entry
114057504         CDS       T05887                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase, inducible
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl00220  Arginine biosynthesis
etl00330  Arginine and proline metabolism
etl01100  Metabolic pathways
etl04020  Calcium signaling pathway
etl04146  Peroxisome
etl04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    114057504 (NOS2)
   00330 Arginine and proline metabolism
    114057504 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    114057504 (NOS2)
   04020 Calcium signaling pathway
    114057504 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    114057504 (NOS2)
Enzymes [BR:etl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     114057504 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 DUF1400
Other DBs
NCBI-GeneID: 114057504
NCBI-ProteinID: XP_027739651
LinkDB
Position
Unknown
AA seq 1146 aa
MLCPWQFVFKSRAAKSHYSGEKDFNNNVEKNRKIRGLGKDDGKLYDPSKKQNKVLPIVTS
AKAREEGENLPQNDIKVSNQISRCPRHVKIRNFENGSSFLDTLHLTAKEVLSCRTKACQG
SLMTPKGQVRGTRDGPVPLEDLLPQAIDFLKQYYSSFKESKMEEYPGRLEIVTKEIETTG
TYHLTKDELTFAAKQAWRNAPRCIGRIQWSNLQVFDARDCKTAQEMFEHICHHIQYATNN
GNIRSAITLFPPRTDGKHDFRVWNSQLIRYAGYTLPDGSVLGDPANAEFTQLCIELGWKP
KYGRFDVLPLVLQANGQDPEIFELPPEIVLEVPMEHPKYEWFKDLDLRWYALPAVSNMLL
EVGGLEFTACPFNGWYMGTEIGVRDFCDVQRYNILKEVGRRMGLETNKLSSLWKDRAVVE
INVAVLHSFQKQNVTIMDHHSASESFMKYMQSEYRARGGCPADWVWIVPPISGSITSVFH
QEMLNYVLTPFYYYQVDAWKTHVWHDETRRPKKKEIKFSMLAKVVLFASSLMRQAMATRT
KVTVIFATETGKSETLAHNLCNLFNCAFNTRILCMDEYNICDLEEETLLLVVTSTFGNGD
SPGNGKTLKNSLFTLKLLRKKIRYAVFGLGSSMYPEFCAFAHTIDQKLAQLGASQLTPVG
EGDELNGQEEAFRTWAVSAFKAACDIFNIRGGHSIQLPEIYTSEESWDPTSYRTVYDSQP
MDLAKALASIHAKDIIPMKLKFRQNLQSLKSSRVTILVKLSCETDQEVHYLPGEHIGIFP
GNQPELVHGIIARVHDAPPADQTIRLETCTDGGYWTSDKKIPACTLPEALTYLLDITTPP
SQQLLKKLSQLVTAEGDKQRLEVLCQSTEEYNKWKFYNNPNILEVLEEFPSAEISTAFLL
TQLPFLKPRYYSVSSSCDMTAREIHLTVAVVNYRTRDGEGPLHHGVCSRWLNTIALDETV
PCFIRSANEFHLPEEPAKPCLLIGSGTGIAPFRSFWLQRLYDLEHRGIKGGDMTLLFGCR
QPDLDHIYREETEEMKRKGVLKEVYTAYSRLPGQPKVYVQDILQSQLEAQVCELLQGQGH
VYVCGDVRMARDVARALRALIARALQLTEQQADEYFFQLKSQKRYHEDIFGAVFPHEVKR
ALQPTS
NT seq 3441 nt   +upstreamnt  +downstreamnt
atgctgtgcccctggcagtttgtgttcaaatctcgtgctgccaagagccactactctgga
gagaaggatttcaataacaacgtggagaaaaataggaagatccgtggcttagggaaggat
gatggcaaattatacgatccgagcaagaagcagaacaaggtgctgcccatcgtgacttcg
gcaaaggccagggaggagggagagaacctccctcaaaatgatatcaaagtttcaaaccaa
atatcaagatgtccaagacatgtaaaaataagaaacttcgaaaatgggtccagctttctt
gacacactacacctgacagcaaaggaggttctcagctgccggaccaaagcctgccaaggg
tcactcatgaccccaaagggccaggtgagaggtaccagagatgggccagttccactggaa
gatcttttgcctcaggcaatagactttctcaagcagtactacagttcatttaaagagtca
aaaatggaagaatacccgggccgactggaaatagtgaccaaggagatagaaactacagga
acctaccatctgacaaaggatgagctgacctttgctgccaaacaggcctggaggaacgca
cccaggtgcattgggagaatccagtggtccaatctacaggtgtttgatgcacgggactgt
aaaacagcacaggaaatgtttgagcatatctgtcatcatattcagtatgccacaaacaat
gggaatataagatccgccatcacgctgttcccgccgaggacggacgggaagcacgatttc
cgtgtgtggaacagccagctgatccgctacgccggctacacgctgcctgacggctctgtc
ctcggagaccccgccaatgccgagttcacccagctgtgcatcgagcttgggtggaagccg
aaatatggccgctttgatgtacttccacttgtcctccaagcaaacggccaagacccagaa
atatttgaattacctccagaaattgtccttgaagtgccaatggagcatccaaagtatgaa
tggtttaaggacctggatctgaggtggtatgcactgcctgctgtgtccaacatgctgctg
gaggtgggaggcctggagttcaccgcgtgtcctttcaacggctggtacatggggacagag
ataggagtgcgagacttctgtgacgtgcagcggtacaacatcctgaaggaggtagggagg
agaatggggctggaaacaaacaaactgtcatcgttgtggaaggaccgagctgttgtagag
atcaatgtggctgtgcttcatagcttccagaaacagaatgtaactatcatggatcaccac
tccgcctccgagtccttcatgaagtacatgcagagcgagtaccgcgcgcgcggcgggtgc
ccggccgactgggtgtggatcgtgcctcccatatcgggcagcataacctctgtgttccac
caggagatgttgaactatgtcctcacccccttctattactaccaggtggatgcatggaaa
acacatgtgtggcatgatgagacccggaggccaaagaaaaaagaaataaagtttagcatg
ctggcaaaggttgtactctttgcatcttcactcatgcgacaagcgatggccaccaggacc
aaggtcactgtaatctttgcaacagagacggggaaatcagaaacacttgcccacaacctg
tgcaacctcttcaactgtgccttcaacactaggattctgtgcatggatgagtacaatatt
tgtgacctggaagaagaaacacttcttttagtggttacaagcacttttgggaatggagat
tctccaggtaacggaaagaccttgaagaactccttgttcacactgaaactgctgagaaaa
aaaattaggtacgctgtgtttggtttggggtccagcatgtatccagagttctgtgccttt
gctcataccattgaccaaaaactggcccagcttggggcttcccagctcactccagtcggt
gaaggggatgagctcaacgggcaagaagaagcctttcgcacctgggcagtcagtgctttc
aaggctgcctgtgacatttttaacatccgtggaggacacagtattcagctgcctgagatc
tacacctctgaggaaagctgggatcctaccagttacaggacagtgtatgactctcagccc
atggacctggctaaagctcttgcaagcattcatgccaaggatataattccaatgaagctg
aaattcaggcagaatcttcaaagtttgaagtccagtcgtgttaccattctggttaaactc
tcctgtgagactgatcaggaagtgcactacctgcctggagaacacatcgggattttccca
ggcaaccagccagaattagtgcatggcattattgcacgtgtccacgatgcccctccagct
gatcagactatcaggcttgaaacctgcactgatggtggctactggaccagtgacaagaag
attccagcctgcacactccctgaggctttgacgtacttgcttgatatcactactccaccc
tcccagcaactgctaaagaaactctcccagctggtgacagcagaaggagataagcagagg
ctggaagtgctgtgtcagagcacagaagaatacaataaatggaagttttacaacaaccca
aacatcctggaggtcctggaggagtttccctctgctgaaatctccacagctttcttgctg
actcagcttccatttctgaagcccaggtactattctgtcagctcctcctgtgacatgaca
gccagagagattcatctgacagttgcagttgtaaactacaggacaagagatggagaaggg
cctttgcaccatggagtctgcagcaggtggctgaacacgatagctcttgatgaaacagtc
ccgtgcttcatacgcagtgctaatgaattccatctcccagaggagccagccaagccctgc
cttctgatcggctcgggcacagggattgctcccttcaggagtttctggctgcagcgtctc
tacgacctggagcacagagggatcaaaggaggtgacatgacattactgttcggctgccgc
cagccagacctggaccacatctacagagaagaaactgaggaaatgaagaggaagggagtc
ctgaaagaggtctacacagcttactccagactgcctggccaacctaaagtgtacgttcag
gacatcctgcagagccagctggaggcacaggtgtgtgagctgctgcagggccaggggcac
gtgtacgtctgcggggacgtgcgcatggcccgggacgtggcgcgggcgctccgcgcgctc
atcgccagggccctgcagctcaccgagcagcaggcagacgagtacttcttccagctcaag
agccaaaaacgataccatgaagatatatttggggctgtgttcccacatgaagtcaaaaga
gctttacaacccaccagttaa

DBGET integrated database retrieval system