KEGG   Empidonax traillii (willow flycatcher): 114058501Help
Entry
114058501         CDS       T05887                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin G/H synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl00590  Arachidonic acid metabolism
etl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:etl00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    114058501 (PTGS1)
Enzymes [BR:etl01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     114058501 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF EGF_2
Motif
Other DBs
NCBI-GeneID: 114058501
NCBI-ProteinID: XP_027741711
LinkDB All DBs
Position
Unknown
AA seq 605 aa AA seqDB search
MGGGCRARAPPAAGLRLLLAHAVLLLCAAGSAARTDSVNPCCYFPCQHQGVCVRVGLEEY
ECDCTRTGYYGVNCTSPEFWTRLHNLLKPSPAFYHFVLTHFKWFWDIINRTFIRDSLMRL
VLTVRANLIPSPPTFNSDYGYISWEAYANVSYYTRVLPPVPVDCPTPMGTKGKQQLPDPQ
LLAERFLLRQKFEADPRGTNMMFAFFAQHFTHQFFKTSGKMGRGFTKALGHGVDLGHLYG
DNLQRQHQLRLFRDGKLKFQVVDGEVYPPRVTDAPVHMVYPPGVPKERQLAMGQEVFGLL
PGLCVYGTLWLREHNRVCDVLRREHPGWDDEQLFQTARLILIGETIKIVVEDYVQHLSGY
YLSLKFDPELLFGSQFQYRNRIAVEFNQLYHWHGLMPDSFVIQGQEYSYQQFLYNTSMLM
DYGVEALVESFSKQVAGRIGGGQTINANVLHVAIGVIKESRQLRLQPFNEYRKRFGMKPY
TSFQELTGEEEKAAELQELYGDIDALEFYPGLLLEKPQPNGIFGESMVEIGAPFSLKGLF
GNPICSPEYWKPSTFGGATGFEIVKTASLERLVCLNVKRCPYVAFHVPDAVEHGSPQGSG
PSTEL
NT seq 1818 nt NT seq  +upstreamnt  +downstreamnt
atgggcggtgggtgccgggcccgggccccgccggccgcggggctgcggctgctgctcgcc
cacgccgtgctgctgctctgcgccgccgggagcgccgcccgcaccgactccgtgaatccc
tgttgctatttcccctgccagcaccaaggggtgtgtgtgagggtcggtctggaagaatac
gagtgtgattgcacgaggacgggatactacggggtcaactgcacctcccctgagttctgg
acgcgcctccacaacctgctgaagcccagccctgccttctaccacttcgtcctgacccac
ttcaagtggttttgggacattatcaacagaaccttcatcagggacagtctcatgaggctc
gtgctgacggttcgtgccaatctcatccccagcccccccactttcaactccgactacggc
tacatcagctgggaggcctatgccaacgtcagctactacacccgcgtcctgccgcccgtg
ccggtcgactgcccgacccccatgggcaccaaagggaagcagcagctgcccgacccccag
ctcctggcagagaggttcctgctgcggcagaagttcgaggctgatccccgaggcaccaac
atgatgtttgccttcttcgcccagcacttcacccaccagttcttcaagacatccgggaag
atgggccggggcttcaccaaggcgctggggcacggggtggacctgggacatctctacggg
gacaacctgcagcggcagcaccagctgcgactcttcagggacgggaaactgaaattccag
gtggtggatggggaggtgtacccccccagggtcaccgacgccccggttcacatggtgtac
ccgcctggcgtccccaaggagaggcagctggccatggggcaggaggtgttcgggctgctg
ccggggctgtgcgtgtacggcacgctgtggctgcgcgagcacaaccgcgtgtgtgacgtg
ctgcggcgggaacaccccggctgggacgacgagcagctcttccagacggcgcggctcatc
ctcatcggggagaccatcaagattgttgttgaagactatgtccagcacctcagtgggtac
tacctgagcctcaagttcgaccccgagctgctgtttgggtcccagttccagtaccggaac
cgcattgcggtggaattcaaccagctctaccactggcacgggctgatgcccgactccttc
gtcatccaggggcaagagtacagctaccagcagttcctctacaacacctccatgctcatg
gactatggtgtggaggcgctggtggagtccttctccaagcaggtggcaggaaggatcggt
gggggacagaccatcaacgccaacgtcctgcatgtggccattggggtcatcaaggaatcc
cggcagctgaggctgcagcccttcaacgagtaccgcaagaggtttggcatgaagccctac
acgtccttccaggagctgacaggagaggaagagaaggcggcggagctgcaggagctgtac
ggagacattgatgccctggagttttatccaggcctgctgctcgagaaaccccaacccaac
ggcatttttggggaaagcatggtggagattggagctccattttccctgaaggggcttttt
ggaaatcccatctgctccccagagtactggaaacccagtacgtttggtggagccaccggc
tttgagatcgtgaagacggcgtcgctcgagaggctcgtgtgcctcaacgtgaagaggtgc
ccgtacgtggcgttccacgtgccagatgctgtggaacacggcagccctcaggggagtgga
ccatctacagagctctag

DBGET integrated database retrieval system