KEGG   Empidonax traillii (willow flycatcher): 114060178
Entry
114060178         CDS       T05887                                 

Gene name
SMURF1
Definition
(RefSeq) E3 ubiquitin-protein ligase SMURF1
  KO
K04678  E3 ubiquitin ligase SMURF1/2 [EC:2.3.2.26]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04120  Ubiquitin mediated proteolysis
etl04144  Endocytosis
etl04340  Hedgehog signaling pathway
etl04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    114060178 (SMURF1)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114060178 (SMURF1)
   04350 TGF-beta signaling pathway
    114060178 (SMURF1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    114060178 (SMURF1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:etl04131]
    114060178 (SMURF1)
   04121 Ubiquitin system [BR:etl04121]
    114060178 (SMURF1)
   03029 Mitochondrial biogenesis [BR:etl03029]
    114060178 (SMURF1)
Enzymes [BR:etl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     114060178 (SMURF1)
Membrane trafficking [BR:etl04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    114060178 (SMURF1)
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    114060178 (SMURF1)
Ubiquitin system [BR:etl04121]
 Ubiquitin ligases (E3)
  HECT type E3
   114060178 (SMURF1)
Mitochondrial biogenesis [BR:etl03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    114060178 (SMURF1)
SSDB
Motif
Pfam: HECT WW C2 HPS3_N
Other DBs
NCBI-GeneID: 114060178
NCBI-ProteinID: XP_027745271
LinkDB
Position
Unknown
AA seq 743 aa
MMVMMPQSAPDVITRKLCFTALTFLYLLFCFAVLCAKNLAKKDFFRLPDPFAKIVVDGSG
QCHSTDTVKNTLDPKWNQHYDLYVGKTDSITISVWNHKKIHKKQGAGFLGCVRLLSNAIS
RLKDTGYQRLDLCKLNPTDTDAVRGQIVVSLQTRDRIGTGGSVVDCRGLLENEGTVYEDS
GPGRPLSCFLEEPAPYTDTTGAAGGGGCRFGESPSQEQRLQAQRLRTPDLRAHAQTPQNR
PHGHQSPELPEGYEQRTTVQGQVYFLHTQTGVSTWHDPRIPRDLNSVNCDELGPLPPGWE
VRSTVSGRIYFVDHNNRTTQFTDPRLHHIMNHQCQLKEPSQQPLPAPNEGSLEEGEELPA
QRYERDLVQKLKVLRHELSLQQPQAGHCRIEVSREEIFEESYRQIMKMRPKDLKKRLMVK
FRGEEGLDYGGVAREWLYLLCHEMLNPYYGLFQYSTDNIYMLQINPDSSINPDHLSYFHF
VGRIMGLAVFHGHYINGGFTVPFYKQLLGKPIQLSDLESVDPELHKSLVWILENDITPVL
DHTFCVEHNAFGRILQHELKPNGRNIPVTEENKKEYVRLYVNWRFMRGIEAQFLALQKGF
NELIPQHLLKPFDQKELELIIGGLDKIDLNDWKSNTRLKHCMADSNIVKWFWQAVETFDE
ERRARLLQFVTGSTRVPLQGFKALQGAAGPRLFTIHLIDANTDNLPKAHTCFNRIDIPPY
ESYEKLYEKLLTAVEETCGFAVE
NT seq 2232 nt   +upstreamnt  +downstreamnt
atgatggtgatgatgccgcagagcgcacctgatgtgattaccaggaagctttgttttacg
gccttaacatttctttatctgctgttttgttttgcagtattatgtgccaagaatcttgca
aagaaagatttcttcagacttcctgacccatttgcaaaaatagttgtggatgggtcaggt
cagtgccattccactgacactgtgaagaacacgttggaccccaaatggaaccagcattac
gatctatacgtcgggaaaacagattccataaccatcagtgtatggaaccataaaaaaatc
cataagaaacagggagctggcttcctggggtgtgtccgactcctctccaatgccatcagc
aggctaaaagatactggataccagcgtttggatctatgcaaactcaaccccacggacacc
gatgctgtccgaggccaaatagtggtcagtttacagacacgggacagaataggcacagga
ggttctgtagtagactgcagagggcttttggagaatgaaggaacggtctatgaagactcc
gggccgggcaggccgctgagctgtttcctggaggagccggcgccctacacggacacgacg
ggagcggccggaggaggcggctgccgcttcggggagtcccccagccaggagcagcggctg
caggcgcagcggctccgcacccccgacctccgagcccacgcccagacacctcagaaccgg
ccccacgggcaccaatcgccagagctgcccgagggctacgagcaaagaacaacggtacag
ggacaggtttattttttgcacacacagactggagttagcacatggcatgacccaaggata
ccaagagaccttaacagtgtgaattgtgatgaactgggacctctgcccccaggctgggaa
gtcagaagtacagtttcaggaagaatatattttgtagatcacaacaacagaaccacacaa
ttcacagatccacgactacatcacatcatgaaccatcaatgccagctgaaagagcccagc
cagcagcctttgccagctccaaatgagggatccctggaagagggggaggagttgcctgca
cagagatacgagagagacttggtacaaaagctgaaagtccttagacatgagctctccctt
cagcaacctcaggctgggcactgtcggattgaagtatccagagaggaaatatttgaggaa
tcctaccgtcagataatgaagatgaggccaaaggacttgaaaaagaggctcatggtgaaa
ttccgaggagaggaaggcctggactatgggggagtagcaagagagtggttgtatttactg
tgccatgaaatgttgaatccctattatggactcttccagtactccacagataatatttac
atgctgcaaatcaatccagactcttctatcaatcctgaccatttgtcttatttccacttt
gtggggcggataatgggtctggctgtgttccatggacactacatcaacggggggttcacc
gtgcccttttacaagcagctcctggggaagcccatccagctctccgacctggagtctgtc
gacccagaattacacaaaagcttagtctggatcttggagaatgacatcacccctgtcctg
gaccatacgttctgtgtggaacacaacgctttcgggaggattttacagcacgagctcaaa
ccaaatggcaggaatattccggtgacagaagagaacaagaaagaatatgtcaggttgtat
gtgaactggcggtttatgagaggaatagaggcacagttcctggctctgcagaaaggtttt
aatgaacttattcctcaacatctccttaagcctttcgaccagaaggaactcgagctcatc
ataggagggctggataagatagacctgaacgactggaagtccaacacccgcctaaagcac
tgcatggccgacagcaacatcgtgaagtggttctggcaggcggtggaaacctttgatgag
gagaggagggccaggctgctgcagttcgtgacgggctcgacgcgtgtcccacttcaaggt
ttcaaggctttacaaggcgctgcaggacccagactgtttaccatccatttaatagatgca
aacacagacaaccttccaaaagcccacacttgctttaaccggatcgacattccgccttac
gagtcatatgagaagctttatgagaagctgttgacagctgtggaagagacatgtgggttt
gctgtggagtga

KEGG   Empidonax traillii (willow flycatcher): 114065996
Entry
114065996         CDS       T05887                                 

Gene name
SMURF2
Definition
(RefSeq) E3 ubiquitin-protein ligase SMURF2 isoform X1
  KO
K04678  E3 ubiquitin ligase SMURF1/2 [EC:2.3.2.26]
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04120  Ubiquitin mediated proteolysis
etl04144  Endocytosis
etl04340  Hedgehog signaling pathway
etl04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04120 Ubiquitin mediated proteolysis
    114065996 (SMURF2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114065996 (SMURF2)
   04350 TGF-beta signaling pathway
    114065996 (SMURF2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    114065996 (SMURF2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:etl04131]
    114065996 (SMURF2)
   04121 Ubiquitin system [BR:etl04121]
    114065996 (SMURF2)
   03029 Mitochondrial biogenesis [BR:etl03029]
    114065996 (SMURF2)
Enzymes [BR:etl01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.2  Aminoacyltransferases
    2.3.2.26  HECT-type E3 ubiquitin transferase
     114065996 (SMURF2)
Membrane trafficking [BR:etl04131]
 Endocytosis
  Clathrin-mediated endocytosis
   Ubiquitin E3 ligases
    114065996 (SMURF2)
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    114065996 (SMURF2)
Ubiquitin system [BR:etl04121]
 Ubiquitin ligases (E3)
  HECT type E3
   114065996 (SMURF2)
Mitochondrial biogenesis [BR:etl03029]
 Mitochondrial quality control factors
  Mitophagy factors
   Parkin-independent mechanism factors
    114065996 (SMURF2)
SSDB
Motif
Pfam: HECT WW C2 HPS3_N
Other DBs
NCBI-GeneID: 114065996
NCBI-ProteinID: XP_027756141
LinkDB
Position
Unknown
AA seq 753 aa
MSNPGARRNGPVKLRLTVLCAKNLVKKDFFRLPDPFAKVVVDGSGQCHSTDTVKNTLDPK
WNQHYDLYIGKSDSITISVWNHKKIHKKQGAGFLGCVRLLSNAINRLKDTGYQRLDLCKL
GPNDNDTVRGQIVVSLQSRDRIGTGGQVVDCSRLFDNDLPDGWEERRTASGRIQYLNHIT
RTTQWERPTRPASEYSSPGRPLSCFVDENTPITGTNGASCGQASDPRLAERRVRSQRHRN
YMSRTHLHTPPDLPEGYEQRTTQQGQVYFLHTQTGVSTWHDPRVPRDLSNINCEELGPLP
PGWEIRNTATGRVYFVDHNNRTTQFTDPRLSANLHLVLNRQNQLKDQQHQQQQQVVSLCQ
LPDEAECLTVPRYKRDLVQKLKILRQELSQQQPQAGHCRIEVSREEIFEESYRQVMKMRP
KDLWKRLMIKFRGEEGLDYGGVAREWLYLLSHEMLNPYYGLFQYSRDDIYTLQINPDSAV
NPEHLSYFHFVGRIMGMAVFHGHYIDGGFTLPFYKQLLGKPITLDDMELVDPDLHNSLVW
ILENDITGVLDHTFCVEHNAYGEIIQHELKPNGKSIPVTEENKKEYVRLYVNWRFLRGIE
AQFLALQKGFNEVIPQHLLKTFDEKELELIICGLGKIDVNDWKANTRLKHCTPDSNIVKW
FWKAVELFDEERRARLLQFVTGSSRVPLQGFKALQGAAGPRLFTIHQIDASTNNLPKAHT
CFNRIDIPPYESYEKLYEKLLTAIEETCGFAVE
NT seq 2262 nt   +upstreamnt  +downstreamnt
atgtccaacccgggggcccggcggaacgggcccgtcaagctgcggctgacagtactgtgt
gcaaaaaacctggtgaaaaaggattttttccgactccccgatccctttgccaaggttgtg
gtggacggctctggccaatgccattctacagatactgtgaagaatacacttgatcccaag
tggaatcagcattatgacctgtacattgggaagtcggattcaataacaatcagtgtgtgg
aatcacaagaaaatccataaaaagcagggagctggttttctgggctgtgtgaggcttctc
tcaaacgccatcaaccgcctcaaagatactggttatcagaggttggatctgtgcaagctt
gggccaaatgacaacgatactgtcagaggacagatagtagtgagtctccagtccagggac
cggataggcactgggggacaagtcgtggattgcagtcggttgttcgacaacgatttgcca
gatgggtgggaggagcgcagaactgcctctggaaggatccagtacttaaatcacatcacg
cggacgacgcagtgggagcgaccgacacggccggcatccgagtactccagcccgggcagg
ccactgagctgctttgtggacgagaacactccgatcacgggcaccaacggcgcgagctgc
gggcaggcgtcagacccccggctggcagagaggagagtccgctcccagaggcacaggaac
tacatgagcaggacacacttgcacactcctcctgatctacctgaaggatatgaacaaagg
acgactcagcaaggccaggtttattttctgcatactcagactggtgtcagcacgtggcac
gatccaagagtacccagggatcttagcaacatcaattgtgaggagcttgggccgctgcct
cctggatgggagatccgaaacacggccacgggcagggtttattttgttgaccataacaac
aggacgacgcagttcacagacccgcggctctccgcgaacctgcacttggtcctaaaccgg
cagaaccagctgaaggaccagcagcaccagcagcagcagcaggtggtgtcgctgtgccag
ctcccggacgaggccgagtgcctgacggtgccgcgctacaagcgggacctggtgcagaag
ctgaagatcctgaggcaggagctgtcccagcagcagccccaggccggccactgtcgcatc
gaggtctccagggaggagatttttgaggaatcctacaggcaagtcatgaagatgaggccc
aaagacctgtggaaacgattaatgatcaaattccgtggggaggaaggccttgattatgga
ggagttgccagggagtggctctacctgttgtcccatgagatgctgaatccatattacggg
ctcttccagtattcccgagatgacatttacaccctgcagatcaaccccgactccgccgtc
aacccggagcacctgtcctatttccacttcgtgggccggatcatgggcatggccgtgttc
cacgggcactacatcgacggcggcttcacgttgcctttctacaagcagttgcttgggaag
ccaattactttggatgacatggaattggtcgaccctgatcttcacaacagcttagtctgg
atacttgagaacgacatcacgggcgtgctggaccacacgttctgcgtggagcacaacgcg
tacggggagatcatccagcacgagctcaaacccaacgggaagagcatccccgtcacagag
gagaacaaaaaggaatatgtcagactttacgtgaactggcggtttttacgaggaattgag
gcgcagttcctggcgctgcagaagggatttaatgaagtaatcccccaacatctgctgaag
acatttgatgagaaggagttggagctcatcatctgtggactgggaaaaatcgacgtgaac
gactggaaggcgaacaccaggttaaaacactgcacccccgacagcaacatcgtcaaatgg
ttctggaaagccgtggagctctttgacgaggagaggagggcgcggctgctgcagttcgtg
accggctcctcccgagtgcccctgcagggcttcaaggcactgcaaggtgctgcaggcccc
cggctcttcaccatccaccagatcgacgccagcaccaataatttaccgaaagctcatacc
tgcttcaacaggatcgacattcccccgtacgagagctacgagaagctctacgagaagctg
ctgacggccatcgaggagacgtgcggcttcgccgtggagtga

DBGET integrated database retrieval system