KEGG   Empidonax traillii (willow flycatcher): 114064786Help
Entry
114064786         CDS       T05887                                 

Gene name
RNPEP
Definition
(RefSeq) aminopeptidase B
  KO
K01260  aminopeptidase B [EC:3.4.11.6]
Organism
etl  Empidonax traillii (willow flycatcher)
Brite
KEGG Orthology (KO) [BR:etl00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01002 Peptidases and inhibitors [BR:etl01002]
    114064786 (RNPEP)
Enzymes [BR:etl01000]
 3. Hydrolases
  3.4  Acting on peptide bonds (peptidases)
   3.4.11  Aminopeptidases
    3.4.11.6  aminopeptidase B
     114064786 (RNPEP)
Peptidases and inhibitors [BR:etl01002]
 Metallo peptidases
  Family M1
   114064786 (RNPEP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Peptidase_M1 Leuk-A4-hydro_C Peptidase_M1_N Peptidase_MA_2
Motif
Other DBs
NCBI-GeneID: 114064786
NCBI-ProteinID: XP_027753932
LinkDB All DBs
Position
Unknown
AA seq 638 aa AA seqDB search
MAAAVRDGPAVRDAASASSAGPWSLRHLQLELRVSFAAAGAGRLRGRARLELRCERDGGA
GAELRLDAHPTLSVSRAALLPPPGGPGDPAGQELPVESRPFASYGSALHITLPQPPRAGQ
LITLLIDYEAGEGPGVCWLAPEQTAGKQKPYMYTQGQAVLNRSFFPCFDTPSVKFTYSAT
VKVPEGFTAVMSATSWEKQKDNTFVFKMSQPIPSYLIALVVGDIVSADVGPRSRVWAEPC
LIEAAKKEYDGVIEEFLVVGEKLFGPYVWGRYDILFMPPSFPFGGMENPCLTFVTPCLLA
GDRSLVDVVIHEISHSWFGNLVTNASWGEFWLNEGFTMYAQRRISTEVYGLPYTCLEAAT
GRALLRQHMDATGEDHPLNKLRVVIEPGINPDDTYNETPYEKGYCFVSYLAHLVGDQSKF
DAFLQAYVNRFKFQSITADDTLAFFLEYFPELKKKGVDSIPGFEFDRWLNTPGWPPYLPD
LSPGQQLMKPAEELAELWAADGLNMEAIEAVDITGWRTYQLVYFLDQVLQKSPLPEGNVE
RLSKMYPKISKAQNAELRLRWCQIVLKNNLEAEYSKVKDFLHSQGKQKYTLPLYRAMWGG
SEATRALAMETFSATAPQLHINVQNYVKKILGLQVAEA
NT seq 1917 nt NT seq  +upstreamnt  +downstreamnt
atggcggctgcggtgcgggacgggccggcggtgcgggacgcggcctctgcgagcagcgcg
ggcccgtggtcgctgcggcacctgcagctggagctccgcgtgtcgttcgcggccgcgggc
gcggggcggctgcggggccgggcgcggctggagctgcgctgcgagcgggacggcggggcg
ggcgcggagctgcggctggacgcgcaccccacgctgtccgtgagccgcgccgcgctcctg
ccgccccccggggggcccggggaccccgccgggcaggagctgcccgtggagagccggccc
ttcgccagctacggcagcgccctgcacatcaccctgccccagcccccccgcgccgggcag
ctcatcaccctcctcatcgactacgaggcgggcgaggggcccggggtgtgctggctggcc
cctgagcagacggcggggaagcagaagccctacatgtacacccagggccaggccgtcctc
aacaggtccttcttcccctgcttcgacaccccctcggtcaagttcacctactcagccacc
gtgaaggtccccgagggcttcacggctgtgatgagtgccacgagctgggagaagcagaag
gacaataccttcgtcttcaagatgtcccagccgatcccctcctacctgatcgctctggtg
gtcggggacattgtgtctgctgacgttggcccaaggagccgcgtctgggccgagccctgc
ctgatcgaggctgccaagaaggagtacgacggggtgatcgaggagttcctggtggttgga
gagaaactctttggaccttatgtttggggcaggtacgacatcctgttcatgccgccctcc
ttccccttcggtgggatggagaacccctgcctgaccttcgtcacgccgtgcctgctggcc
ggggaccgctcgctggtggacgtcgtcatccacgagatctcccacagctggttcggcaac
ctggtcaccaacgcctcgtggggcgagttctggctgaacgagggcttcaccatgtacgcc
cagaggcgcatctccaccgaggtctacggtctgccctacacctgcctggaggctgccacg
ggaagggccctcctgcgccagcacatggacgccacgggggaggaccatcctctcaacaag
ctgcgggtggtgattgagccaggcatcaacccagacgacacgtacaacgagacgccctac
gagaagggctactgcttcgtcagctacctggcccatctggtgggtgaccagagcaagttc
gatgccttcctccaggcctacgtgaaccggttcaagttccagagcatcaccgcagatgac
accctcgcattcttcctggagtacttcccagagctgaagaagaaaggcgtggactccatc
ccagggttcgagttcgaccgctggctgaacacgccgggctggccgccctacctgcccgac
ctgtccccggggcagcagctgatgaagccggcggaggagctggcagagctctgggcagcc
gacggcttgaacatggaggccatcgaagccgtggacatcacaggctggaggacgtaccag
ctggtctatttcctggatcaggtcctgcagaaatcccccctgcccgaaggtaatgtggaa
aggctgagcaagatgtaccccaagatctccaaggcccagaacgctgagctgcgactgcgc
tggtgtcagatcgtcctcaagaacaacctggaggctgagtacagcaaagtcaaggacttc
ctgcacagccagggaaagcagaagtacacactgcccctctaccgggccatgtggggcggg
tcagaggccacccgggccctggccatggagaccttctctgccacggccccccagctccac
atcaacgtccaaaactatgtgaagaagatcctgggcttgcaggtggcagaggcctaa

DBGET integrated database retrieval system