KEGG   Empidonax traillii (willow flycatcher): 114066680
Entry
114066680         CDS       T05887                                 

Gene name
KITLG
Definition
(RefSeq) kit ligand
  KO
K05461  KIT ligand
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04010  MAPK signaling pathway
etl04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    114066680 (KITLG)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    114066680 (KITLG)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:etl04052]
    114066680 (KITLG)
Cytokines and growth factors [BR:etl04052]
 Growth factors
  Growth factors (RTK binding)
   114066680 (KITLG)
SSDB
Motif
Pfam: SCF
Other DBs
NCBI-GeneID: 114066680
NCBI-ProteinID: XP_027757350
LinkDB
Position
Unknown
AA seq 285 aa
MKKAQTWIITCFCLQLLLLNPLVKAQSSCGNPVTDDVNDIAKLVGNLPNDYMITLKYVPK
MDSLPDHCWLHLMVPEFSRSLHNLLQKFSDISDMSDVLSNYSIINNLRRIINDLMACLDF
DKNKDFVKENGHLYEEGRFIPEDFFRHFNTTIEVYKEFADTVDKNDCILPSTVETPKNDS
RVAVTKTFLFPPVAASSLRNDSIGTSTSSNKEALGFIRSSSLQGISIALTSLLSLLIGFI
LGAIYWKKTHPESRPESVETTQCHDCQEENEISMLQQKEKEHLQV
NT seq 858 nt   +upstreamnt  +downstreamnt
atgaagaaggcacaaacttggattatcacttgcttttgtcttcaactactcctacttaat
cctcttgtcaaagcccagagttcctgcgggaatccagtcacagatgatgtgaatgacatt
gcaaaattggttggaaatcttccaaatgattatatgataacccttaaatatgtcccaaag
atggatagtctgcctgatcactgttggttgcatttgatggtgcctgaattttcaaggagt
ctacataatcttctccagaaattttcggatatttcagatatgtcagatgttttaagcaac
tattcaatcatcaataatctcagaaggataattaatgatcttatggcatgcctcgatttt
gataaaaacaaggattttgtaaaagagaatggtcacctttacgaagaaggtcgcttcatt
cctgaggatttttttaggcactttaatactaccattgaggtctacaaggagtttgcagac
acagtggataagaatgactgcattctgccttcaacagtagaaacaccaaagaatgattcc
agagtcgctgtcacaaaaacatttttgtttcctcctgttgctgccagctcccttaggaat
gacagcattggcactagcactagcagtaacaaagaagctcttggcttcattcgcagctcc
agcctgcaagggatcagcatagcattgacatcattgctgtctcttcttattggctttatt
ttgggagccatatactggaagaaaacccatcctgaatccagaccagaaagtgttgaaact
acacagtgtcatgactgtcaagaggaaaatgagataagtatgttgcagcaaaaagaaaag
gaacatctacaagtgtag

DBGET integrated database retrieval system