KEGG   Empidonax traillii (willow flycatcher): 114067050
Entry
114067050         CDS       T05887                                 

Gene name
XPO1
Definition
(RefSeq) exportin-1
  KO
K14290  exportin-1
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl03008  Ribosome biogenesis in eukaryotes
etl03013  RNA transport
etl05164  Influenza A
Brite
KEGG Orthology (KO) [BR:etl00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    114067050 (XPO1)
   03008 Ribosome biogenesis in eukaryotes
    114067050 (XPO1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05164 Influenza A
    114067050 (XPO1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:etl03019]
    114067050 (XPO1)
   03009 Ribosome biogenesis [BR:etl03009]
    114067050 (XPO1)
   03016 Transfer RNA biogenesis [BR:etl03016]
    114067050 (XPO1)
   03036 Chromosome and associated proteins [BR:etl03036]
    114067050 (XPO1)
Messenger RNA biogenesis [BR:etl03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    Ran-mediated transport factors
     114067050 (XPO1)
Ribosome biogenesis [BR:etl03009]
 Eukaryotic type
  Pre-40S particles
   Export and cytoplasmic maturation factors
    114067050 (XPO1)
  Pre-60S particles
    114067050 (XPO1)
Transfer RNA biogenesis [BR:etl03016]
 Eukaryotic type
  tRNA transport factors
   tRNA export factors
    114067050 (XPO1)
Chromosome and associated proteins [BR:etl03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Regulators of centriole replication
     114067050 (XPO1)
SSDB
Motif
Pfam: CRM1_C Xpo1 CRM1_repeat_2 CRM1_repeat_3 CRM1_repeat IBN_N Hydrolase_3
Other DBs
NCBI-GeneID: 114067050
NCBI-ProteinID: XP_027758032
LinkDB
Position
Unknown
AA seq 1071 aa
MPAIMTMLADHAARQLLDFNQKLDINLLDNVVNCLYHGEGAQQRMAQEVLTHLKEHPDAW
TRVDTILEFSQNMNTKYYGLQILENVIKTRWKILPRNQCEGIKKYVVGLIIKTSSDPTCV
EKEKVYIGKLNMILVQILKQEWPKHWPTFISDIVGASRTSESLCQNNMVILKLLSEEVFD
FSSGQITQVKAKHLKDSMCNEFSQIFQLCQFVMENSQNAPLVHATLETLLRFLNWIPLGY
IFETKLISTLIYKFLNVPMFRNVSLKCLTEIAGVSVSQYEEQFVTLFTLTMMQLKQMLPL
NTNIRLAYSNGKDDEQNFIQNLSLFLCTFLKEHGLLIEKRLNLRETLMEALHYMLLVSEV
EETEIFKICLEYWNHLAAELYRESPFSTSASPLLSGSQHFDVPPRRQLYLPVLSKVRLLM
VSRMAKPEEVLVVENDQGEVVREFMKDTDSINLYKNMRETLVYLTHLDYADTERIMTEKL
HNQVNGTEWSWKNLNTLCWAIGSISGAMHEEDEKRFLVTVIKDLLGLCEQKRGKDNKAII
ASNIMYIVGQYPRFLRAHWKFLKTVVNKLFEFMHETHDGVQDMACDTFIKIAQKCRRHFV
QVQVGEVMPFIDEILNNINTIICDLQPQQVHTFYEAVGYMIGAQTDQTLQEHLIEKYMLL
PNQVWDSIIQQATKNVDILKDPETVKQLGSILKTNVRACKAVGHPFVIQLGRIYLDMLNV
YKCLSENISAAIQANGEMVTKQPLIRSMRTVKRETLKLISGWVSRSSDPQMVAENFVPPL
LDAVLIDYQRNVPAAREPEVLSTMAIIVNKLGGHITAEIPQIFDAVFECTLNMINKDFEE
YPEHRTNFFLLLQAVNSHCFPAFLAIPPAQFKLVLDSIIWAFKHTMRNVADTGLQILYTL
LQNVAQEETAAQSFYQTYFCDILQHIFSVVTDTSHTAGLTMHASILAYMFNLVEEGKIST
PLNPGNPVNNQMFIQEYVANLLKSAFPHLQDAQVKLFVTGLFSLNQDIPAFKEHLRDFLV
QIKEFAGEDTSDLFLEERETALRQAQEEKHKLQMSVPGILNPHEIPEEMCD
NT seq 3216 nt   +upstreamnt  +downstreamnt
atgccagcaattatgacaatgttagcagaccatgcagctcgtcagctgctggattttaac
cagaaactggatatcaatctcttggacaatgtggtgaactgcttgtaccatggagaaggt
gcacagcaaagaatggcacaggaagtgttgactcacttaaaagaacatcccgatgcgtgg
acaagagttgatacaattttggagttctctcagaacatgaacaccaaatattatgggctg
caaatcttggaaaatgtgataaaaacaagatggaagattcttccaaggaaccagtgcgaa
ggtattaaaaaatacgttgtcggcctaattatcaagacctcatcagacccaacgtgtgta
gaaaaagagaaagtgtacattgggaaactgaatatgattctcgttcagatcttgaaacag
gagtggcccaagcactggcccaccttcataagtgacatcgtgggggccagcaggaccagt
gagagcctctgtcagaacaacatggtcatcctcaaactcctgagcgaggaggtgttcgat
ttttccagcggccagatcactcaagtgaaagccaagcatttgaaagacagcatgtgcaat
gaattctcgcagatatttcagctgtgtcagtttgtgatggaaaactcccaaaatgctccc
ttagtccacgcaactttggaaactttgctacgatttctgaactggattcctctgggatat
atatttgagaccaagttaatcagcacactaatatacaagttcttaaatgttcccatgttc
cgaaacgtgtctctgaagtgcctcacagagattgcaggggtcagtgtcagccagtacgag
gagcagtttgtgacactttttaccctgaccatgatgcagttaaaacagatgcttccttta
aataccaatatccgacttgcatactcgaatggcaaagatgatgaacagaacttcatccag
aacctcagtttgttcctctgcacgttcctcaaggagcacgggctgctgatagaaaaaaga
ttaaatctgagggaaacactaatggaggctcttcattacatgttgttggtatcagaagtt
gaagaaacggaaattttcaagatctgtctcgaatattggaaccatttggctgctgagctc
tacagggaaagtcccttctcaacatctgcttctccactgctttcggggagccaacacttc
gatgttcctcccaggaggcagctttacctgcctgttctgtccaaggtgcggttgctcatg
gtgagccgcatggccaagcctgaggaggtcctggttgtggagaacgatcaaggggaggtg
gttcgggaattcatgaaggacacagactccataaacttgtataaaaacatgagagagaca
ctggtttacctgacacacctggactatgcagacacagagcgaattatgactgagaaactc
cacaatcaggtgaatgggacggagtggtcgtggaagaacctgaacaccctgtgctgggcc
atcggctccatcagcggcgcgatgcacgaggaggacgagaagagattcctcgtgacagta
attaaggatctcctgggactgtgtgaacaaaagcgaggcaaggacaataaagccattatt
gcatcaaatataatgtatatagtaggtcaataccctcggtttttgagagctcactggaaa
ttcttgaagacagtagtcaacaagctgtttgaatttatgcatgaaacccacgatggtgtc
caggacatggcttgtgacaccttcatcaaaatcgcccagaagtgccgccggcattttgtg
caggtgcaggtgggagaggtgatgccgtttatcgacgaaatcttgaacaacatcaacaca
atcatctgtgaccttcagccacagcaggtgcacacgttttacgaagcggtcgggtacatg
atcggggcacagacggaccagacgctgcaggagcacctgatagaaaagtacatgttgctg
cccaaccaggtgtgggacagcatcatccagcaggcaacaaagaatgtcgatatcctgaag
gatcctgaaacagtcaagcagcttggtagcatcctgaaaaccaacgtaagagcgtgcaaa
gcagtcggccacccctttgtgattcagcttggaagaatttatttagatatgctgaatgtg
tacaagtgcctaagtgaaaatatttctgcagctattcaggctaatggtgaaatggtaaca
aagcagcccttgattagaagtatgaggactgtaaaaagggaaactctcaaactgatttct
ggctgggtgagcaggtccagtgatccacagatggtagctgaaaactttgttcctccgttg
ttggacgcagttctcatcgactaccagcgcaacgtgcccgcggcgcgggagcccgaggtg
ctcagcaccatggccatcatcgtcaacaagctgggggggcacatcaccgctgaaatacct
cagatcttcgatgctgtctttgagtgcacactaaacatgatcaacaaggactttgaagaa
tatcctgaacatagaacaaacttcttcttgctactgcaggctgtaaattctcactgcttc
ccagccttcctggccattccacctgcacagttcaaacttgttctggattctatcatttgg
gctttcaaacataccatgagaaacgttgcagatacaggacttcagatcctttacactctc
ctccagaacgttgcccaggaggagacggccgcccagagcttctaccagacgtatttctgc
gacatcctccagcacatcttctccgtggtgacagacacctcgcacactgcaggtctgacg
atgcacgcgtcgatcctggcctacatgttcaacctggtggaagaggggaagatcagtact
cccttgaaccccgggaatccggtgaacaaccagatgtttatccaggagtacgtggccaat
ctcctcaagtctgcatttcctcacctgcaagatgcccaggtgaagctgttcgtgacggga
ctgttcagtttaaaccaggatattcctgccttcaaggaacacctaagggatttcctggtc
caaatcaaggaatttgcaggtgaagacacatcagacttattcttggaggagagagaaaca
gcccttcgacaggctcaagaggagaagcataaacttcagatgtctgtccccggcatcctt
aatccacatgaaattcctgaggagatgtgcgattaa

DBGET integrated database retrieval system