KEGG   Empidonax traillii (willow flycatcher): 114068542
Entry
114068542         CDS       T05887                                 

Gene name
HHIP
Definition
(RefSeq) hedgehog-interacting protein
  KO
K06231  hedgehog interacting protein
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114068542 (HHIP)
SSDB
Motif
Pfam: GSDH EGF_2
Other DBs
NCBI-GeneID: 114068542
NCBI-ProteinID: XP_027760556
LinkDB
Position
Unknown
AA seq 697 aa
MMLKMLPFKLLLVAVVLCFFEGDAKFGESGARRRRCLNGTPPRRLKKRDRRVLSPEAPGG
GEAMCRGLYPRLSCCSRSEPQGLPHAEAKILSVTNNTECAKLLEEIKCAHCSPHAQNLFH
SPEKGDTAERELTLPYLCKDYCKEFYYTCRGHIPGFLQTTADEFCYYYSRKDGGVCFPDF
LRKQVRGPASNSLDHMEEYDKEEEISRKHKHNCFCIQEVVSGLRQPVGAVHCGDGSHRLF
ILEKEGYVKIFTPEGDIIKEPFLDIHKLVQSGIKGGDERGLLSLAFHPNYKQNGKLYVSY
TTNQERWAIGPHDHILRVVEYTVSRKNPHQVDMRTARVFLEVAELHRKHLGGQLLFGPDG
FLYIFLGDGMITLDDMEEMDGLSDFTGSVLRLDVNTDLCNVPYSIPRSNPHFNSTNQPPE
IFAHGLHNPGRCAVDRHPTDVNINLTILCSDSNGKNRSSARILQIVKGKDYESEPSLLEF
KPFSSGSLVGGFVYRGCQSERLYGSYVFGDRNGNFLTLQQSPATKQWQEKPLCLGNTGSC
RGFFSGPVLGFGEDELGEIYILSSSKSMTQPHSGRLYKIVDPKRPLVPEECKRTAQPAQI
LTSECSRHCRNGHCTPTGKCCCNQGWEGDFCRTAKCDPACRHGGVCVRPNKCLCKKGYLG
PQCEQVDRSIRRVTRAGILDQILDMTSYLLDLTSYIV
NT seq 2094 nt   +upstreamnt  +downstreamnt
atgatgctcaagatgctgccgtttaagctgctgctagtggccgtggttctatgcttcttc
gagggggatgccaagtttggggagagtggcgcccggaggagaaggtgcctcaacgggacc
ccgccgcggcggctgaagaagcgggaccggcgggtgctgtccccggaggccccgggcggc
ggggaggcgatgtgccgcggcctctacccacgcctgtcctgctgctcccgctccgagccg
caggggctgccgcacgccgaggcgaagatactttctgttacgaacaacacagaatgtgcg
aagctactggaggaaatcaaatgtgcacactgctcacctcacgctcagaacctattccac
tcacctgagaaaggggacactgctgaaagagaactaactcttccctacttgtgcaaagac
tattgtaaagaattctattatacttgcagaggtcacataccaggttttctccaaactaca
gctgatgagttttgttattactattcaagaaaagatggtggcgtgtgctttccagatttt
ctaagaaaacaagtgcgagggccagcctctaactccctggaccacatggaagaatatgac
aaagaggaagagatcagcagaaaacacaagcacaactgcttctgcattcaggaggttgtg
agtggactaaggcagcctgttggagcagtacattgtggggatggatcccatcgcctcttc
attctagagaaagaaggatatgtgaagattttcactcccgaaggagacataatcaaggaa
ccttttttggatatacacaagcttgtacaaagtggaataaagggaggagatgaaagagga
ctgttaagccttgcattccatcccaattacaagcaaaatggaaagctgtatgtgtcttat
accaccaaccaagaacggtgggctattggacctcatgaccacatccttagggtggtagaa
tacacagtatccaggaaaaatccacaccaagttgatatgaggacagcaagagtgttttta
gaggtagcagaactacatcgaaaacatctaggaggacagcttctgtttggcccagatggt
ttcctgtacatttttctcggagatggcatgatcactctagatgacatggaggagatggat
ggtttaagtgattttacaggctctgtattgcgcctcgacgtaaatactgacctgtgcaat
gtcccttattccataccacggagcaacccacatttcaatagcacaaaccagcctcctgag
atttttgcacatggactccacaatccaggccggtgtgctgtggaccgccatccaactgat
gtaaacatcaatttaactatactttgttcagattcaaatggaaagaacagatcttcagca
agaatcttacaaattgtaaagggcaaagactatgaaagcgagccctcacttttagaattc
aaaccattcagcagtggatccctggttggtggatttgtctatcgaggctgtcagtctgaa
agactctatggaagttatgtatttggagaccgcaatggaaattttttaacactgcaacag
agtcctgcaaccaaacagtggcaagagaaaccactctgtcttggcaacactggctcatgt
agaggtttcttttcaggccctgtcttgggattcggcgaagatgaattaggtgagatttac
atattatccagcagtaaaagtatgacacagcctcacagcggaagactctacaagattgtt
gacccaaagaggcctttagtccctgaagaatgcaaaagaactgctcagcctgcacagata
ctgacatctgaatgctcaaggcattgtcggaatgggcactgcactcccacaggaaaatgt
tgctgtaatcaagggtgggaaggagacttctgcagaactgcaaaatgtgacccagcctgt
cgacatggaggtgtctgtgtaaggcctaataaatgcttgtgtaaaaaaggctatctcggc
ccccagtgtgagcaagtcgatagaagcatccgaagagtgacaagggcaggtattcttgat
cagatcctagacatgacatcctatttgctggatctaaccagctatattgtatag

DBGET integrated database retrieval system