KEGG   Empidonax traillii (willow flycatcher): 114069119
Entry
114069119         CDS       T05887                                 

Gene name
MDM4
Definition
(RefSeq) protein Mdm4
  KO
K10127  protein Mdm4
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    114069119 (MDM4)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:etl04121]
    114069119 (MDM4)
Ubiquitin system [BR:etl04121]
 Ubiquitin ligases (E3)
  Single Ring-finger type E3
   MDM2/MDM4 proteins
    114069119 (MDM4)
SSDB
Motif
Pfam: zf-C3HC4_3 SWIB zf-RanBP zinc_ribbon_15
Other DBs
NCBI-GeneID: 114069119
NCBI-ProteinID: XP_027761503
LinkDB
Position
Unknown
AA seq 475 aa
MTSPSPAQHPAAESSCRITLGQANQVRPTLPLLRILQAAGAQGDTFTLKEVMHYLGQYIM
VRQLYDKRQQHMVYCGGDQLGELLGLDSFSVKDPSPLYDMLKRNLTAAALTDAAQTLPKE
QSVDKPSQDQLKLSQEEGSGAGSAAGEESKASALSTSEQNCDTHQDKDLIENLSKSKKPK
LDLVFEEWDVAGLPWWFLGNLRSNYKSRSNGSTDIQTNQDIDTAIVSDTTDDLWFLNECP
LDQGSAGLKVEVLDCEEVKEGDTKVTEDVCLNDFEDSQCLSDDTDTEAASEDCWQCTKCK
KFNSPGKRYCYRCWALRKGWYSDWPRLAHSLSLSSIAARKNKEEEEEDEGIDVPDCKRTL
SAPAGQPTRVFRVETKPPCGSIESLDLARAHESKESLLSFAESKKEEEIESLESIKTLLN
PCFLCQHRPRDGNIVHGRTAHLVACFRCARMLKKRRSPCPVCRKEIEMVIRIFMG
NT seq 1428 nt   +upstreamnt  +downstreamnt
atgacctcccccagccctgcccagcacccagcagctgagagctcctgcaggatcactctg
ggacaagctaaccaggtgaggcccacactgccactcctgaggattctgcaggcagcagga
gcccaaggagacaccttcaccctcaaggaggtgatgcattacctgggccagtacatcatg
gtgaggcagctctacgacaaaaggcagcagcacatggtctattgtggaggggatcagctg
ggagagctgctgggcctggacagcttctctgtaaaagatccaagccccctgtatgacatg
ttgaaacggaacctgacggcggctgcgctcacagatgctgcacagactctcccaaaggag
cagagcgtcgataagccaagccaagaccagctgaagctcagccaggaggaaggttctggt
gctgggagcgctgcgggggaggagagcaaggcctctgctttgtctacctcagagcagaac
tgtgacactcatcaagacaaagacttaatagaaaacctctctaaaagcaagaagcctaaa
ctggacctagtgtttgaggaatgggatgtagctggtcttccatggtggtttttaggcaac
ctcagaagcaattacaagtccagaagtaatggatcaacagatattcagactaaccaggac
attgacactgccattgtttcggatactactgacgacctgtggttcctcaacgagtgcccc
ttggaccagggcagtgctgggctcaaggtggaggtgcttgactgtgaggaagtgaaagaa
ggtgacacaaaggtgactgaggatgtgtgtttgaatgactttgaggactctcagtgcttg
agtgatgacacggacacagaagctgcttctgaggactgctggcaatgcaccaagtgcaag
aagttcaactccccgggcaaacggtactgctaccgctgctgggccctgcgcaagggctgg
tactcagactggcccaggctggcccactccctctccctgtccagcattgctgccaggaaa
aacaaggaggaggaagaggaggatgagggcatagacgtgccagactgcaaaaggaccctg
tcggctccggccgggcagcccacccgtgtcttcagggtggagaccaaacccccctgcggc
tccatcgagtctctggacctggcacgggcccatgagagcaaagagtctctgctgagcttc
gctgagagtaaaaaggaggaagaaatcgagtctctggagagtataaaaaccctgctgaac
ccctgcttcctgtgccagcaccggccccgcgacggcaacatcgtccacggcaggactgct
cacctcgtggcctgcttcaggtgtgccaggatgctgaagaaaaggagatccccctgccca
gtgtgcaggaaggagatcgagatggtcatcaggatcttcatggggtag

DBGET integrated database retrieval system