KEGG   Empidonax traillii (willow flycatcher): 114069681
Entry
114069681         CDS       T05887                                 

Gene name
GTSE1
Definition
(RefSeq) G2 and S phase-expressed protein 1 isoform X1
  KO
K10129  G-2 and S-phase expressed protein 1
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    114069681 (GTSE1)
SSDB
Motif
Pfam: GTSE1_N
Other DBs
NCBI-GeneID: 114069681
NCBI-ProteinID: XP_027762438
LinkDB
Position
Unknown
AA seq 729 aa
MDAFLYTMEEGKEMSVCASHVPEEKLYCMSNVSDFPLLSDEKFDFDLSLSSTSGNEDEVF
VGAVGHKERCIAASMEAKKSVSAFDDKLMWSPLQEEKFVEIFKEAHLLAQQIKTGSKNEE
TKTSQSGEQENKITETFVEDSESKLKILRNKMIEKSPRAVKRETYNVQDSPAYLLPPCFQ
KASDKLLSDGKLHALPTPPNRSPVKICVSPTKIANLSLTQEEKSKETNTKATGKLAMAKP
SCTLGRSNLLTIEKLKSGKNTSISTKRDLNSKGSSEDLISDKSSVASDVFDSSFSGSSSV
QDTKGLPAPSKLCSLIQPGLRKMTYLKLPGVASGLTRRTASSSLSSLSSVNSSLNSSLPF
SPIVKKEKSSMSSKVSVSGSSTSRLALVRPTRLSSLQAANTEKSRKQVRSASTPKISSAV
TLAKSSSSATSSEAAGSGIQRPSSVPSLQQLCQQNKDGSATKGDLCPKPKARVLSVSTSQ
TKVPVKTQDATPNKLAQKAASSLGLTFCGTPGSAMAVSTPMKASEDKVFQNFCFPERPAS
MTPAMKPSGLPTPVRRISGFPAVTPKTVPRMAFSPHVASLHQSSSFSTKKALAAGSRQKQ
ESKTQISSSEDDVSPPPVLPLALTFSPEKTAAEVAENELKEAEVQNQLAEEKQPVALLVD
IGVDNSLSHTFEYENRPLIDLSNTPEVNKITSPKPVLSGQIKLIDLSSPLITLSPDVNKE
NLDSPLLKF
NT seq 2190 nt   +upstreamnt  +downstreamnt
atggacgcgttcctgtacacaatggaggaaggaaaagaaatgtcagtgtgtgcgagtcat
gtgcctgaagaaaaactgtactgcatgagcaatgtttcagactttcctcttctgagtgat
gagaagtttgattttgacctttcactctcttcaacaagtggaaatgaagatgaggttttt
gttggagctgtggggcacaaagaaagatgtattgctgctagtatggaagcaaaaaagagt
gtgtctgcttttgatgataaactcatgtggagcccacttcaagaagagaaatttgtggaa
attttcaaagaagctcatttgttggcacagcagataaagactggaagcaagaatgaagag
actaaaacaagccaatcaggagaacaggaaaataagattacagaaacatttgtggaggac
tcagagtcaaagttgaaaatactgagaaacaaaatgatagaaaaaagtcccagggctgtt
aaacgggagacatacaatgtgcaggatagcccagcatatctgctgccaccttgttttcag
aaggcatcggataaacttttgtcagatggcaaattacatgctcttcctactcctccaaac
agaagccctgtaaaaatttgtgtgtctcctacaaaaatcgccaatttgtctctgacacaa
gaagagaaatctaaggaaacaaacacaaaggcaactggcaaactggcaatggcaaaacct
tcatgtacacttggaaggagcaatttgttgactattgaaaagctcaaatcaggaaaaaat
actagtatttctacaaaaagagacttgaacagcaagggatcatctgaagatctaatttct
gataaatctagtgttgcttcagatgtcttcgattcctcattcagcggcagttcttcagtg
caagacacaaaaggccttcctgcaccaagtaagctatgttctttgattcagcctggctta
aggaagatgacgtatctgaaacttcctggtgttgccagtggtctcacaagaaggactgca
tcatcatctttgtcatcactttccagtgtgaactcaagtctgaattcaagcttacccttt
tctcccatagtaaaaaaagaaaaatcaagcatgtcatccaaagttagtgtgagtggctca
agtacaagcaggctggcccttgtcagacctaccagactgtcatctctgcaggctgccaat
actgagaaatccaggaagcaagtgagatcagctagtactcccaaaatatctagtgctgta
accttggctaaatcttcatcttctgcaacatcatctgaggctgcaggcagtggaattcag
agaccgagctctgttcccagcctgcagcagctctgtcagcagaataaagatggaagtgca
acaaaaggagacctgtgtccaaagcccaaggctagagttttgtctgtttccacaagtcaa
actaaggttcccgtgaagactcaagatgcgacaccaaacaaactggcacaaaaagcagca
tcatctcttggattaacattttgtggtacacctggaagtgccatggcagtcagcactcct
atgaaagcctcagaagataaggtctttcagaatttttgttttcctgagaggcctgcctcc
atgactcctgccatgaaaccatctggcttacctacacctgtccgtcggatctcgggattc
ccagcagtgacccctaagactgtaccaagaatggcattttctccacatgttgcatctctt
caccaaagttccagcttttctaccaaaaaggctcttgcagctggttctagacagaaacaa
gagagtaagacacagatatcttcttcagaagatgatgtatctcctccacctgtgctacct
cttgctcttaccttctcaccggaaaaaactgctgcagaagtagcagaaaacgaactaaaa
gaggctgaagtacaaaatcagctggctgaagagaaacaacctgtggccttactagtagac
attggagtagacaattctctctcacacacttttgaatatgaaaatagacctctgattgac
ctttccaacactcccgaagtgaataagattacttctccaaagcctgtgttgtctgggcag
ataaagttaattgatttgagttcgcctctcatcactctgagtcctgatgtaaacaaagaa
aacctggattcccctctgctcaagttctga

DBGET integrated database retrieval system