KEGG   Empidonax traillii (willow flycatcher): 114070065
Entry
114070065         CDS       T05887                                 

Gene name
SMO
Definition
(RefSeq) smoothened homolog
  KO
K06226  smoothened
Organism
etl  Empidonax traillii (willow flycatcher)
Pathway
etl04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:etl00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    114070065 (SMO)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:etl04030]
    114070065 (SMO)
G protein-coupled receptors [BR:etl04030]
 Frizzled / Smoothened family
  114070065 (SMO)
SSDB
Motif
Pfam: Frizzled Fz
Other DBs
NCBI-GeneID: 114070065
NCBI-ProteinID: XP_027763058
LinkDB
Position
Unknown
AA seq 685 aa
MPKCEDGQVELPSQTLCQATRAPCTIVERERGWPDFLKCTTDRFPEGCPNEVQNIKFNSS
GQCEAPLVRTDNPKSWYEDVEGCGIQCQNPLFTEKEHREMHVYIAAFSSVTIFCTFFTLA
TFVADWRNSNRYPAVILFYINACFFVGSIGWLAQFMDGARDEIVCRADGTMRLGEPTSNE
TLSCVIIFVIVYYSLMSGVIWFVMLTYAWHTSFKALGTTYQPLLGKTSYFHLITWSIPFV
LTVAILAVAQVDGDSVSGICFVGYKNYRYRAGFVLAPIGLVLIVGGYFLIRGVMTLFSIK
SNHPGLLSEKAASKINETMLRLGIFGFLAFGFVFITFGCHFYDFFNQAEWERSFREYVLC
EANVTIATQTNKPIPDCEIKNRPSLLVEKINLFAMFGTGVSMSTWVWTKATLLIWKRTWC
RLTGQSDDQPKRIKKSKMIAKAFSKRKELLRDPGRELSFSMHTVSHDGPVAGLAFDINEP
SADVSSAWAQHVTKMVARRGAILPQDISVTPVATPVPPEERANLWIVEADISPELQKRSS
RKKKRRKKKKEVDPGPERCLGGSTAPLAPSTVPRLPRLPPQPCLVAFAPDVLPGLPPGRP
DATFSGVPWDGHRRANVFHLISNPFCPEGGALEEESPGRWQHNGGPLWAPNPGGPRTQGR
RAGLAPIHSRTNLVDAELLDPDSDF
NT seq 2058 nt   +upstreamnt  +downstreamnt
atgcccaagtgcgaggatgggcaggtggagctgcccagccagaccctgtgccaggccacc
cgggccccctgcaccatcgtggagcgcgagcgaggctggcccgacttcctcaagtgcacg
accgaccgattccccgagggctgcccgaacgaggtgcagaacatcaagttcaacagctcg
gggcagtgcgaggcgccgctggtgcgcaccgacaaccccaagagctggtacgaggacgtg
gagggctgcggcatccagtgccagaacccgctgttcaccgagaaggagcaccgcgagatg
cacgtctacatcgccgccttcagctccgtcaccatcttctgcaccttcttcaccctggcc
acctttgtcgctgactggaggaactccaaccgctaccccgctgtcatcctgttctacatc
aacgcctgcttcttcgtgggcagcatcggctggctggcgcagttcatggacggcgcccgt
gacgagatcgtgtgccgcgccgacggcaccatgcgcctgggggagcccacgtccaacgag
acgctctcctgcgtcatcatcttcgtcatcgtttactactcactgatgtcgggagtcatc
tggtttgtcatgctgacctacgcctggcacacctccttcaaggccctgggcaccacctac
cagccgctgctgggcaagacctcctacttccacctcatcacctggtccatccccttcgtc
ctcactgtggccatcctggccgtggcgcaggtggatggtgactctgtcagtggcatctgc
ttcgtgggctacaagaactaccgctaccgagccggcttcgtcctggcgcccatcgggctc
gtcctcatcgtggggggctatttcctcatccggggggtcatgacgctcttctccatcaag
agcaaccaccccgggctgctgagcgagaaggcggccagcaagatcaacgagaccatgctg
cgcctgggcatctttggcttcttggccttcggcttcgtcttcatcacctttggctgccac
ttctacgacttcttcaaccaggcagagtgggagcgcagctttcgggaatacgtcctgtgc
gaggccaacgtgaccatcgccacgcagaccaacaagcccatcccggactgcgagatcaag
aaccggccgagcctgctggtggagaagatcaacctcttcgccatgttcggcaccggcgtc
tccatgagcacctgggtctggaccaaggccactctgctcatctggaagcgcacctggtgc
aggctgacggggcagagcgacgaccagcccaagaggatcaagaagagcaagatgatcgcc
aaggccttctccaagcgcaaggagctgctgcgggacccgggccgggagctgtccttcagc
atgcacaccgtgtcacacgacggccctgtggccggtttagccttcgacatcaacgagccg
tcggctgacgtgtcctcggcctgggcccagcacgtcaccaagatggtggccaggagaggg
gccatcctgccccaggacatctccgtgacacccgtggcaacacctgtgccaccggaggag
agggccaacctctggatcgtggaagccgacatctcccccgagctgcagaagcgcagcagc
cgcaagaagaagcggaggaagaagaagaaggaggtggacccaggccccgagcgctgcctg
gggggctccacggcccccctggcccccagcaccgtccctcgcctgccccgcctgcccccc
cagccctgcctggtggccttcgcccccgacgtcctcccggggctcccgcccggccggccc
gacgccaccttctccggggtgccatgggatgggcaccgcagagccaacgtcttccacctc
atcagcaaccccttctgccccgagggcggggccctggaggaggagagccccgggcgctgg
cagcacaacgggggcccgctctgggcccccaaccccggggggccgaggactcagggccgc
cgggccgggctggcccccatccactcccggaccaacctggtggacgcggagctgctggac
cccgactcggacttctga

DBGET integrated database retrieval system