KEGG   Escherichia coli UMNK88 (ETEC, porcine): UMNK88_2403Help
Entry
UMNK88_2403       CDS       T02001                                 

Definition
(GenBank) cytoplasmic alpha-amylase
  KO
K01176  alpha-amylase [EC:3.2.1.1]
Organism
eun  Escherichia coli UMNK88 (ETEC, porcine)
Pathway
eun00500  Starch and sucrose metabolism
eun01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:eun00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    UMNK88_2403
Enzymes [BR:eun01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.1  alpha-amylase
     UMNK88_2403
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Alpha-amylase Glyco_hydro_70 Alpha-amylase_C DUF1939
Motif
Other DBs
NCBI-ProteinID: AEE56988
UniProt: A0A0E0TZG7
LinkDB All DBs
Position
2310895..2312382
Genome map
AA seq 495 aa AA seqDB search
MRNPTLLQCFHWYYPEGGKLWPELAERADGFNDIGINMVWLPPAYKGASGGYSVGYDSYD
LFDLGEFDQKGSIPTKYGDKAQLLAAIDALKRNDIAVLLDVVVNHKMGADEKEAIRVQRV
NADDRTQIDEEIIECEGWTRYTFPARAGQYSQFIWDFKCFSGIDHIENPDEDGIFKIVND
YTGEGWNDQVDDELGNFDYLMGENIDFRNHAVTEEIKYWARWVMEQTQCDGFRLDAVKHI
PAWFYKEWIEHVQEVAPKPLFIVAEYWSHEVDKLQTYIDQVEGKTMLFDAPLQMKFHEAS
RMGRDYDMTQIFTGTLVEADPFHAVTLVANHDTQPLQALEAPVEPWFKPLAYALILLREN
GVPSVFYPDLYGAHYEDVGGDGQTYPIDMPIIEQLDELILARQRFAHGVQTLFFDHPNCI
AFSRSGTDEYPGCVVVMSNGDDGEKTIHLGENYGNKTWRDFLGNRQESVVTDENGEATFF
CNGGSVSVWVIEEVI
NT seq 1488 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaatcccacgctgttacaatgttttcactggtattacccggaaggcggtaagctc
tggcctgaactggccgagcgcgccgacggttttaatgatattggtatcaatatggtctgg
ttgccgcccgcctataaaggcgcatcgggcgggtattcggtcggctacgactcctatgat
ttatttgatttaggtgagtttgatcagaaaggcagcatccctactaaatatggcgataaa
gcacaactgctggccgccattgatgctctgaaacgtaatgacattgcggtgctgttggac
gtggtagtcaaccacaaaatgggcgcggatgaaaaagaagctattcgcgtgcagcgtgta
aatgctgacgaccgtacgcaaattgatgaagaaatcattgagtgcgaaggctggacgcgt
tacaccttccccgcccgtgccgggcaatactcacagtttatctgggatttcaaatgtttt
agcggtatcgaccatatcgaaaaccctgatgaagatggcatatttaaaattgttaacgac
tacaccggcgaaggctggaacgatcaggttgatgatgaattaggtaatttcgattatctg
atgggcgagaatatcgattttcgcaatcatgccgtgacggaagagattaaatactgggcg
cgctgggtgatggaacaaacgcaatgcgacggttttcgtcttgatgcggtcaaacatatt
ccggcgtggttttataaagagtggatcgaacacgtacaggaagttgcgccaaagccgctg
tttattgtggcggagtattggtcgcatgaagtcgataaactgcaaacgtatattgatcaa
gtggaaggcaaaaccatgctgttcgatgcgccgctgcagatgaaattccatgaagcatcg
cgcatggggcgcgactacgacatgacgcagattttcacgggtacattagtggaagccgat
cctttccacgccgtgacgctcgttgccaatcacgacacccaaccattgcaagccctcgaa
gcaccggtcgaaccgtggtttaaaccgctggcgtatgctctaattttgttgcgggaaaat
ggcgttccttcggtgttctatccggacctctacggtgcgcattacgaagatgtcggtggt
gacgggcaaacctatccgatagatatgccaataatcgaacagcttgatgagttaattctc
gcccgtcagcgtttcgcccacggtgtacagacattatttttcgaccatccgaactgcatt
gcctttagccgcagtggcactgacgaatatcccggctgcgtggtggtcatgtcgaacggg
gatgatggcgaaaaaaccattcatctgggagagaattacggcaataaaacctggcgtgat
tttctggggaatcggcaagagagcgtagtgaccgacgaaaacggcgaagcgaccttcttt
tgcaacggcggcagcgtcagcgtgtgggttatcgaagaggtgatttaa

DBGET integrated database retrieval system