KEGG   Ficedula albicollis (collared flycatcher): 101817488
Entry
101817488         CDS       T02815                                 

Gene name
NOS2
Definition
(RefSeq) nitric oxide synthase 2
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
fab  Ficedula albicollis (collared flycatcher)
Pathway
fab00220  Arginine biosynthesis
fab00330  Arginine and proline metabolism
fab01100  Metabolic pathways
fab04020  Calcium signaling pathway
fab04146  Peroxisome
fab04371  Apelin signaling pathway
Brite
KEGG Orthology (KO) [BR:fab00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    101817488 (NOS2)
   00330 Arginine and proline metabolism
    101817488 (NOS2)
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    101817488 (NOS2)
   04020 Calcium signaling pathway
    101817488 (NOS2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    101817488 (NOS2)
Enzymes [BR:fab01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     101817488 (NOS2)
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1 DUF1400
Other DBs
NCBI-GeneID: 101817488
NCBI-ProteinID: XP_005056635
UniProt: U3JQR4
LinkDB
Position
19
AA seq 1147 aa
MLCPWQFVFKSHAAKSRYPREKDINNNVETNRKIHGSGKDDAKLHSPSKKQMERPPTITS
AKPSEGGENLPSNDIKVSNQIPGCPRHVKVKNLENGSSFLDTLHLTAKEVINCRTKACQG
SLMTPKGLVRGTRDGPVPQEDLLPQAIDFLKQYYSSFKEPKPKEQLGRLEAVTKEIESTG
SYQLTRDELTFAAKQAWRNAPRCIGRIQWSNLQVFDARDCKTAKEMFERICCHIQYATNN
GNIRSAITVFPQRTDGRHDFRVWNSQLIRYAGYQLPDGSVLGDPATLEFTQLCIELGWKP
KYGRFDVLPLVLQANGQDPEIFELPPEIVLQVPMEHPKYEWFKELELQWYALPAVASMLL
EVGGLEFTACPFNGWYMGTEIGVRDFCDTQRYNILQEVGRRMGLETNKLSSLWKDRAVVE
INVAVLHSFQKQNVTIMDHHSAAESFLKHMQGEYRARGGCPADWLWIVPPMSGSITPVFH
QEMLNYVLTPFYYYQVDAWKTHVWHDETRRPRKKEIKFSILAKAVLFASSLMRGAVATRA
RVTVIYATETGKSETLAHDLCSLFCCAFSTQILCMDEYNICDLEKETLLLVVTSTFGNGD
SPGNGKTFKDSLLRLKLLRNKIRYAVFGLGSSMYPEFCAFAHAIDQKLAQLGASQLTPVG
EGDELSGQEAAFHSWAVSAFKTACDIFNVRGRHSIQLPEIYTSEESWDPSSYRLVHDSQP
MDLAKALASIHAKNVIPMKLKFRQNLQSLKSSRVTILVKLHCETDQEVHYLPGEHVGVFP
GNQPELVHGIIARVKDAPPAGQTVRLETCIDGGYWTSHKKIPACTLSEALTYLLDITTPP
SQELLKKLSQLVTAEGDKQRLEVLCQSTEEYNKWKFYNSPNILEVLEEFPSAEVSTAFLL
TQLPFLKPRYYSVSSSCDMTAREIHLTVAVVNYRTRDGEGPLHHGVCSTWLNTIELNETV
PCFIRSANEFHLPEEAATPCILIGAGTGIAPFRSFWLQRLYDLEHRGLRAGDMILVFGCR
QPELDHIYREETEEMKRKGVLRDIYTAYSRLPGQEKVYVQDILQRQLEARVCEVLQGQQG
HVFVCGDVRMARDVARALRALLARGLRLSQQQAEQYLQQLKTQKRYHEDIFGALFPHEVK
RSLQPTS
NT seq 3444 nt   +upstreamnt  +downstreamnt
atgctgtgcccctggcaatttgtgttcaaatctcacgctgccaagagccgctaccccaga
gagaaggatatcaacaacaacgtggagacaaataggaagatccatggctcaggaaaggat
gatgccaaactgcacagtccaagcaagaagcagatggagaggccacctaccataacttca
gcaaagcccagtgagggaggagagaatcttccttcaaatgacatcaaagtttcaaaccaa
ataccaggatgtccaagacatgtaaaagtaaaaaacttggaaaatggatccagctttctt
gacacactacacctgactgcaaaagaggttatcaattgccggaccaaagcctgccaaggg
tcactcatgaccccaaagggcctggtgagaggtaccagagatgggccagttccacaagaa
gatcttttacctcaggcaatagacttcctcaagcagtactacagttcatttaaagagcca
aaacccaaagagcagctgggcaggctggaagcagtgaccaaggagatagaaagcacagga
agctaccagctgaccagggatgagctgacctttgctgccaagcaggcctggaggaacgcc
cccaggtgcatcgggaggatccagtggtccaacctgcaggtgtttgatgcacgggactgt
aaaacagccaaggaaatgtttgagcggatctgttgccatatccagtatgccacaaacaat
ggtaatataaggtcggccatcacggtgttcccgcagaggacggacgggcggcacgatttc
cgcgtgtggaacagccagctcatccgctacgctggctaccagctgccagatggctctgtg
ctcggggaccctgccaccctggagttcacacagttgtgcatcgagcttgggtggaagccg
aaatatggacgctttgatgtacttccacttgttctccaagcaaatggccaagacccagaa
atatttgaattacctccagaaattgtcctccaagtgccaatggagcatccaaagtacgag
tggtttaaggagctggagctgcagtggtatgccctgcctgccgtggccagcatgctgctg
gaggtgggagggctggagttcactgcctgtcccttcaacggctggtacatgggcacagag
atcggcgtgcgggacttctgcgacacccagcgctacaacatcctgcaggaggtagggagg
agaatgggactggaaacaaacaaactgtcatcgttatggaaggaccgagctgttgtggag
atcaatgtggctgtgcttcacagcttccagaagcagaatgtgaccatcatggatcaccac
tcggctgccgagtccttcctgaagcacatgcagggcgagtaccgcgcgcggggcggctgc
cccgcagactggctctggatcgtgccgcccatgtcaggcagcatcacccccgtgttccac
caggagatgctgaactacgtcctcactcccttctattactaccaggtggatgcatggaaa
acacatgtgtggcatgatgagacccggaggccaaggaaaaaagaaataaagtttagcatc
ttggcaaaggctgtgctctttgcatcctcactcatgcgaggagcagtggccaccagggcc
agggtcaccgtgatctacgcgaccgagacgggcaagtcagagactctcgcccacgacctg
tgcagcctgttctgctgtgccttcagcacccagattctgtgcatggatgagtacaacatt
tgtgacctggaaaaagaaacacttctcttagtggttactagcacttttggaaatggagat
tctccaggtaacggaaagaccttcaaggactccttgcttagactgaaactgctgagaaat
aaaattagatatgcagtgtttggtctggggtccagcatgtacccagagttctgtgctttt
gctcatgccattgaccagaagctggcccagctcggggcttcccagctcactccagtgggt
gaaggggatgaactcagtgggcaagaagcagctttccacagctgggcagtcagtgctttc
aagactgcctgtgacatttttaatgtccgcgggagacatagtattcagttgcctgagatc
tacacctctgaggagagctgggacccttccagttacaggctagtgcatgactcccagccc
atggacctggctaaagctcttgcaagcattcatgccaagaatgtaattcccatgaagctg
aaattcaggcagaatcttcaaagtttgaagtccagccgtgttaccattctggtaaaactt
cactgtgagactgatcaggaagtgcactaccttcctggggagcacgttggggttttccca
ggcaaccagccagagttagttcatggcattattgcacgtgtcaaggatgcccctccagct
ggtcagactgtgagacttgaaacctgcattgatggtggatattggacaagtcacaaaaag
attccagcctgcacattatccgaggctttgacatacttgctggatatcactactccaccc
tcccaagagctgctgaaaaaactctcccagctggtgacagcagaaggagacaagcagagg
ctggaggtgttgtgtcagagcacagaagaatacaataaatggaagttttacaacagcccc
aacatcctggaggtgctcgaggagttcccctctgctgaggtctccacagctttcctgctg
actcagctgccatttctgaagcccaggtattattctgtcagctcctcctgtgacatgaca
gccagggagattcaccttacagttgcagttgtaaactacaggacaagagatggagagggg
cctttgcaccacggggtctgcagcacgtggctgaacacaatagagctcaacgaaaccgtt
ccctgcttcatccgcagtgctaatgagttccacctcccggaggaggcagccacgccctgc
attctgatcggcgcgggcacggggatcgctcccttcaggagcttctggctgcagcgcctc
tacgacctggagcacagagggctcagagcaggggacatgatcttggtgttcggctgccgg
cagccagagctggatcacatctacagagaggaaactgaggagatgaagaggaagggagtc
ctgagagacatctacacagcttactccagactgcctggccaagagaaagtctatgtccag
gacatcctgcagaggcagctggaggcccgtgtgtgtgaggtgctgcagggccagcagggc
cacgtgttcgtgtgcggggacgtgcgcatggcgcgggacgtggcgcgagcactgcgggcg
ctgctggcccggggcctgcgcctcagccagcagcaggcagagcagtacctgcagcagctc
aagacccaaaagcgataccatgaagatatatttggggctctgttcccacatgaagtcaaa
agatctttgcaacccaccagctga

DBGET integrated database retrieval system