KEGG   Felis catus (domestic cat): 101081817
Entry
101081817         CDS       T02385                                 

Gene name
EIF4B
Definition
(RefSeq) eukaryotic translation initiation factor 4B isoform X2
  KO
K03258  translation initiation factor 4B
Organism
fca  Felis catus (domestic cat)
Pathway
fca03013  RNA transport
fca04150  mTOR signaling pathway
fca04151  PI3K-Akt signaling pathway
fca05205  Proteoglycans in cancer
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09122 Translation
   03013 RNA transport
    101081817 (EIF4B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04151 PI3K-Akt signaling pathway
    101081817 (EIF4B)
   04150 mTOR signaling pathway
    101081817 (EIF4B)
 09160 Human Diseases
  09161 Cancer: overview
   05205 Proteoglycans in cancer
    101081817 (EIF4B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:fca03019]
    101081817 (EIF4B)
   03012 Translation factors [BR:fca03012]
    101081817 (EIF4B)
Messenger RNA biogenesis [BR:fca03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Transport factors
    eIF4F and regulatory proteins
     101081817 (EIF4B)
   mRNA cycle factors
    Stress granule specific factors
     101081817 (EIF4B)
Translation factors [BR:fca03012]
 Eukaryotic type
  Initiation factors
   eIF-4
    101081817 (EIF4B)
SSDB
Motif
Pfam: RRM_1 RRM_7
Other DBs
NCBI-GeneID: 101081817
NCBI-ProteinID: XP_003988796
Ensembl: ENSFCAG00000000300
LinkDB
Position
B4
AA seq 611 aa
MAASAKKKNKKGKTISLTDFLAEDGGTGGGSTYVPKPVSWADETDDLEGDVSTTWHSNDD
DVYRAPPIDRSILPTAPRAAREPNIDRSRLPKSPPYTAFLGNLPYDVTEDSIKEFFRGLN
ISAVRLPREPSNPERLKGFGYAEFEDLDSLLSALSLNEESLGNRRIRVDVADQAQDKDRD
DRSFGRDRNRDSDKTDTDWRARPATDSFDDYPPRRGDDSFGDKYRDRYDSDRYRDGYRDG
YRDGPRRDMDRYGGRDRYDDRGSRDYDRGYDSRIGSGRRAFGSGYRRDDDYRGGGDRYED
RYDRRDDRSWSSRDDYSRDDYRRDDRGPPQRPKLNLKPRSTPKEDDSSASTSQSSRAASI
FGGAKPVDTAAREREVEERLQKEQEKLQRQLDEPKLERRPRERHPSWRSEETQERERSRT
GSESSQTGTSATSGRNARRRESEKSLENETLNKEEDCHSPTSKPPKPEQPLKVMPAPPPK
ENAWVKRSSNPPARSQSSDTEQQSPTSGGGKVVPAQPSEEGPARKDENKVDGVSVPKGQS
GNSSRGPGDGGNKDHWKESDRKDGKKDQDSRSAPEPKKPEENPASKFSSASKYAALSVDG
EDENEGEDYTE
NT seq 1836 nt   +upstreamnt  +downstreamnt
atggcggcctcagcaaaaaagaagaataagaaggggaaaactatctccctaacagacttt
ctggctgaggatggagggactgggggaggaagtacttatgtccccaaaccagtcagctgg
gctgatgaaacagacgacctggaaggagatgtttcaaccacttggcacagtaacgatgat
gacgtgtatagggcacctccaattgaccgttccatcctgcccactgctccacgggctgct
cgggaacccaatatcgaccggagccgtcttccaaaatcgccaccctatactgcttttcta
gggaacctgccctatgatgtgacagaagattccattaaggaattctttagaggattaaat
atcagtgcagtgcgtttaccacgtgaacccagcaatccagagaggttgaaaggttttggt
tacgctgagtttgaggacctggattctttgctcagtgccctgagcctcaacgaagagtct
ctaggtaacaggagaattcgagtggacgttgctgatcaagcacaagataaagaccgggat
gatcgttcttttggccgagatagaaatcgggattctgacaaaacagatacggactggagg
gcacgtcctgccacagacagcttcgatgactacccgcctaggagaggcgatgatagcttt
ggagacaagtatcgagatcgttatgattcagaccgataccgtgatgggtatcgggatgga
tatcgggatggcccacgccgagatatggatcgatacgggggccgggatcgctatgatgac
cgaggcagcagagactatgatagaggttacgattccaggataggcagtggcagaagagca
tttggtagcgggtaccgtagggatgatgactatagaggaggcggggaccgctatgaagac
agatacgacagacgagatgatcggtcatggagttccagagatgattactctcgggatgat
tataggcgtgatgatagaggtcccccccaaagacccaaactgaatctaaagcctcggagt
actcctaaggaagatgattcctctgctagcacctcccagtccagtcgagcagcctctatc
tttggaggggcgaagcccgttgacacagctgctagagagcgagaagtagaggagcggcta
cagaaggagcaggagaaactgcagcgccagctggatgagcccaagctagagcgacggcct
cgggagcgacacccaagctggcgaagtgaagaaactcaggaacgggaacggtccaggaca
ggaagtgagtcatcacagactgggacctcagccacatctggcagaaatgcacgaaggaga
gagagtgagaagtctctagaaaatgaaacactcaataaggaggaagactgtcactctcca
acttctaagcctcccaaacctgaacaacctctaaaggtaatgccagcccctccaccaaag
gagaatgcttgggtgaagcgaagttctaaccctcctgctcgatctcagagctcagacaca
gagcagcagtcccctacaagtggtggggggaaagtagttccggctcaaccatctgaggaa
ggaccagcaaggaaagatgaaaacaaagtagatggggtgagtgtcccaaaaggccaaagt
gggaactccagccgtggtccaggagacggagggaacaaagaccactggaaggagtcagat
aggaaagatggcaaaaaggatcaagactcccgatctgcacctgagccaaagaaacctgaa
gaaaatccagcttccaagttcagttctgcaagcaagtatgctgctctctccgttgatggc
gaagatgagaacgagggagaagattacaccgaatag

DBGET integrated database retrieval system