Felis catus (domestic cat): 101091308 Help Entry 101091308         CDS       T02385                                  Symbol POLD4 Name (RefSeq) DNA polymerase delta subunit 4   KO K03505   DNA polymerase delta subunit 4 Organism fca  Felis catus (domestic cat) Pathway fca03030   DNA replication fca03410   Base excision repair fca03420   Nucleotide excision repair fca03430   Mismatch repair fca03440   Homologous recombination Brite KEGG Orthology (KO) [BR:fca00001]  09120 Genetic Information Processing   09124 Replication and repair    03030 DNA replication     101091308 (POLD4)    03410 Base excision repair     101091308 (POLD4)    03420 Nucleotide excision repair     101091308 (POLD4)    03430 Mismatch repair     101091308 (POLD4)    03440 Homologous recombination     101091308 (POLD4)  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03032 DNA replication proteins [BR:fca03032]     101091308 (POLD4)    03400 DNA repair and recombination proteins [BR:fca03400]     101091308 (POLD4) DNA replication proteins [BR:fca03032]  Eukaryotic type   DNA Replication Elongation Factors    DNA polymerase delta complex     101091308 (POLD4) DNA repair and recombination proteins [BR:fca03400]  Eukaryotic type   SSBR (single strand breaks repair)    BER (base exicision repair)     Long Patch-BER factors      DNA polymerase delta complex       101091308 (POLD4)    MMR (mismatch excision repair)     DNA polymerase delta complex      101091308 (POLD4) BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  DNA_pol_delta_4 DUF3303 Motif Other DBs NCBI-GeneID:  101091308 NCBI-ProteinID:  XP_003993745 Ensembl:  ENSFCAG00000026317 UniProt:  M3WUS6 LinkDB All DBs Position D1:complement(109997887..109999697) Genome browser AA seq 107 aa AA seqDB search MGRKRLITDSYPVVKRREGPAGHSKGELAPELGEEPQPLSVDEAELELLRQFDLAWQYGP CTGITRLQRWHRAEQMGLEPPAEVRQVLQTHPGDPRFQYSLWHVYPL NT seq 324 nt NT seq  +upstreamnt  +downstreamnt atgggccggaagcggctcatcactgactcctaccctgtagtgaagaggcgggagggcccc gctgggcacagcaagggggagctggcgccagagctaggggaagagccccagcctctgagc gtggatgaagcagagctggagctgctgaggcagtttgatctggcctggcaatatgggccc tgcacagggatcacgcggctgcagcgctggcatcgggccgagcagatgggcttggagccc cccgctgaagtgcgccaggtgctgcagacccaccctggagatccccgcttccagtacagc ctctggcacgtctatcccctttga

DBGET integrated database retrieval system