KEGG   Felis catus (domestic cat): 101094849
Entry
101094849         CDS       T02385                                 

Gene name
ATF6B
Definition
(RefSeq) cyclic AMP-dependent transcription factor ATF-6 beta isoform X4
  KO
K09049  cyclic AMP-dependent transcription factor ATF-6 beta
Organism
fca  Felis catus (domestic cat)
Pathway
fca04022  cGMP-PKG signaling pathway
fca04141  Protein processing in endoplasmic reticulum
fca04151  PI3K-Akt signaling pathway
fca04211  Longevity regulating pathway
fca04261  Adrenergic signaling in cardiomyocytes
fca04668  TNF signaling pathway
fca04728  Dopaminergic synapse
fca04911  Insulin secretion
fca04915  Estrogen signaling pathway
fca04918  Thyroid hormone synthesis
fca04925  Aldosterone synthesis and secretion
fca04926  Relaxin signaling pathway
fca04927  Cortisol synthesis and secretion
fca04928  Parathyroid hormone synthesis, secretion and action
fca04934  Cushing syndrome
fca04935  Growth hormone synthesis, secretion and action
fca05020  Prion disease
fca05030  Cocaine addiction
fca05031  Amphetamine addiction
fca05034  Alcoholism
fca05161  Hepatitis B
fca05163  Human cytomegalovirus infection
fca05166  Human T-cell leukemia virus 1 infection
fca05203  Viral carcinogenesis
Brite
KEGG Orthology (KO) [BR:fca00001]
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   04141 Protein processing in endoplasmic reticulum
    101094849 (ATF6B)
 09130 Environmental Information Processing
  09132 Signal transduction
   04668 TNF signaling pathway
    101094849 (ATF6B)
   04022 cGMP-PKG signaling pathway
    101094849 (ATF6B)
   04151 PI3K-Akt signaling pathway
    101094849 (ATF6B)
 09150 Organismal Systems
  09152 Endocrine system
   04911 Insulin secretion
    101094849 (ATF6B)
   04915 Estrogen signaling pathway
    101094849 (ATF6B)
   04926 Relaxin signaling pathway
    101094849 (ATF6B)
   04935 Growth hormone synthesis, secretion and action
    101094849 (ATF6B)
   04918 Thyroid hormone synthesis
    101094849 (ATF6B)
   04928 Parathyroid hormone synthesis, secretion and action
    101094849 (ATF6B)
   04925 Aldosterone synthesis and secretion
    101094849 (ATF6B)
   04927 Cortisol synthesis and secretion
    101094849 (ATF6B)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101094849 (ATF6B)
  09156 Nervous system
   04728 Dopaminergic synapse
    101094849 (ATF6B)
  09149 Aging
   04211 Longevity regulating pathway
    101094849 (ATF6B)
 09160 Human Diseases
  09161 Cancer: overview
   05203 Viral carcinogenesis
    101094849 (ATF6B)
  09164 Neurodegenerative disease
   05020 Prion disease
    101094849 (ATF6B)
  09165 Substance dependence
   05030 Cocaine addiction
    101094849 (ATF6B)
   05031 Amphetamine addiction
    101094849 (ATF6B)
   05034 Alcoholism
    101094849 (ATF6B)
  09167 Endocrine and metabolic disease
   04934 Cushing syndrome
    101094849 (ATF6B)
  09172 Infectious disease: viral
   05166 Human T-cell leukemia virus 1 infection
    101094849 (ATF6B)
   05161 Hepatitis B
    101094849 (ATF6B)
   05163 Human cytomegalovirus infection
    101094849 (ATF6B)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:fca03000]
    101094849 (ATF6B)
Transcription factors [BR:fca03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   CREB
    101094849 (ATF6B)
SSDB
Motif
Pfam: bZIP_1 bZIP_2 bZIP_Maf DUF4407 GIT_CC ZapB YabA Docking
Other DBs
NCBI-GeneID: 101094849
NCBI-ProteinID: XP_003986008
Ensembl: ENSFCAG00000018408
LinkDB
Position
B2
AA seq 712 aa
MAGGREGKMAELMLLSEIADPTRFFTDNLLSPEDWGLRNSTLYTGLDDVAEEQTQLFRCP
EQDVPFGSSSLDVGMDVSPPEPPWDPLPIFPDLQVKSEPSSPCSSSSLSSESSRLSTEPS
SQVPAVGEVLVVKTESLAPPLCLLGDDPTSPFETVQINVGPTSDDPSDVQTKLEPVSPSS
SINSEASLLSAESPNQGFIGEEVLEVKTESPSPQGCLLRDVLGPPLGGVQISMGPSSDGS
LGKALPTRKPPLQPKPVVITTVPMPPRAVPPSTTILLQPLVQPPPVSPVVLIQGAIRVQP
EGPAPPAPRPERKSIVPAPMPGNSCPPEVDAKLLKRQQRMIKNRESACQSRRKKKEYLQG
LEARLQAVLADNQQLRRENAALRRRLEALLAENSELKLGSGNRKVVCIMVFLLFIAFNFG
PVSISDPPPAPISPRMSGEEPRPRRHLLEFSAQEPVHGVEPLQGSSLGPEEPQPSPPGRP
SFRNLTAFPGGSAKELLLRDLDQLFLSSDCRHFNRTESLRLADELSGWVQRHQRGRRKIP
QRAQEKQKSQLWKKSPPVKAVPTQPPGPPERDSAGQLQLYRHPDRSQPEFLDAIDRREDT
FYVVSFRRDHLLLPAISHNKTSRPKMSLVMPAMAPNETLSGRGAPGDYEEMMQIECEVMD
TRVIHIKTSTVPPSLRKQPSSTPGNATGGPLPASAAGQARQASHQPLYLNHP
NT seq 2139 nt   +upstreamnt  +downstreamnt
atggctggggggcgggagggaaagatggcggaactgatgctgctcagcgagattgcggac
ccaacacgttttttcaccgataacttgctgagcccggaggactggggtctgcggaacagc
accttgtatactggcttagatgatgtcgcggaggagcagacgcagctcttccgttgccca
gagcaggatgtcccgtttggcagcagttccctggacgtggggatggatgtcagccctcct
gagccaccctgggaccccctgcctatctttccagatcttcaggtgaagtctgagccgtcc
tccccctgctcctcttcctccctcagctctgaatcatcgcgtctttccacagagccctct
agccaggtccctgctgtaggggaggtgctggttgtgaagacagagtccttggcaccccca
ctctgcctcctaggagatgatccaacatccccatttgaaacggtccagatcaatgtgggt
cccacctctgatgacccctcagatgtccagaccaagctagagcctgtctctccatcttcc
tccatcaactctgaggcttccctgctctcagcagagtcccccaaccagggttttatagga
gaggaggtactggaagtgaagacagagtcaccatcccctcaagggtgtctcctgcgggat
gtcctaggccccccacttggaggtgtccagatcagcatgggcccatcctccgatggctcc
ttaggcaaagccctgcctacccggaagccaccgctgcagcccaaacctgtggtgataacc
actgtcccaatgccacccagagctgtgcctcctagcaccaccatccttttgcagcctctt
gtccaaccacccccagtgtcaccagttgtcctcatccaaggtgctattcgggtccagcct
gaggggccggccccccctgctccaaggcctgagaggaagagcattgttccagctcctatg
cctgggaactcctgcccacctgaagtggatgcaaagctgctgaagcggcagcagcgaatg
atcaagaaccgggagtcggcctgccagtccaggaggaagaagaaggagtatctgcagggg
ctggaggctcggctgcaggctgtgctggccgacaaccagcagctccgcagggagaatgct
gccctccggcggcggctggaggccctgctggccgaaaacagcgagctcaagttagggtct
ggaaacaggaaggtggtctgcatcatggtgttccttcttttcattgccttcaactttgga
cctgtcagcatcagtgaccctcctccagctcccatctctcctcggatgagcggagaggag
cctcgaccccggagacacttgctggagttctcagcgcaagagccggttcatggagttgaa
cccctccagggttcctccctgggccctgaggagccccagcccagccccccaggccggcca
agtttcaggaacctgacagccttcccggggggcagtgccaaggagctgctgctgagagac
ctggaccagctcttcctctcctctgattgccggcacttcaaccgaaccgagtccctgagg
cttgcggacgagctgagcggctgggtccagcgtcaccagagaggccggcggaagatcccc
cagagggcccaggagaaacagaagtctcagctctggaagaagtcgcctccagttaaggca
gttcccacccagccccctgggcccccagaaagggattctgcgggccaactgcagctatat
cgccacccagaccgttcgcagccagagttcctggatgcaattgaccgacgagaagacaca
ttttatgttgtgtccttccgaagggaccacttgctgctccctgccatcagccacaacaag
acctctcggcccaagatgtccctggtgatgcctgccatggcccccaatgagaccctgtca
ggccggggggctccaggagactatgaggagatgatgcagatcgagtgtgaggtcatggac
acccgggtgattcacatcaagacctccacggtgcctccctcgctccgaaaacagccatcc
tcgaccccaggcaatgccacaggtggccccttgccagcttctgcagccggccaggcacgc
caggcctcccaccagcccctctacctcaatcacccctga

DBGET integrated database retrieval system