KEGG   Folsomia candida: 110853707Help
Entry
110853707         CDS       T05043                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn]-like
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
fcd  Folsomia candida
Pathway
fcd04146  Peroxisome
fcd04213  Longevity regulating pathway - multiple species
Brite
KEGG Orthology (KO) [BR:fcd00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    110853707
 09150 Organismal Systems
  09149 Aging
   04213 Longevity regulating pathway - multiple species
    110853707
Enzymes [BR:fcd01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     110853707
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 110853707
NCBI-ProteinID: XP_021957709
LinkDB All DBs
Position
Unknown
AA seq 154 aa AA seqDB search
MPQKAVCVLKGDKVQGTVWFNQEAEGKPVAVTGEIKGLGAGLHGFHVHEFGDTTDGCTSA
GPHFNPKGKTHGGPGDAERHVGDLGNVTAGGDGVAKIDVKDSLISLFGENNVVGRTMVVH
ADPDDLGKGGHELSKTTGNAGARVACGVIGLAKA
NT seq 465 nt NT seq  +upstreamnt  +downstreamnt
atgccacaaaaagcagtatgcgttctcaagggagataaggttcagggaaccgtttggttt
aatcaggaggctgaagggaaaccagtcgcagtgactggagaaatcaaggggctcggcgct
ggtcttcatggatttcatgtccacgaatttggagatacgaccgacggctgcacctccgcc
gggccacatttcaacccgaaggggaaaacccacggaggtcctggcgatgctgagcgccac
gttggagacttgggtaatgtgaccgcagggggtgacggagtggccaaaattgacgttaag
gacagtctgatttcgctctttggtgaaaacaatgtggtcggaaggacaatggtggtccat
gctgaccccgacgatttgggaaaaggtggtcacgagttgagcaagacaactggaaatgct
ggagctcgagtggcttgtggggttatcggtttagctaaagcttga

DBGET integrated database retrieval system