KEGG   Flavobacterium kingsejongi: FK004_15155Help
Entry
FK004_15155       CDS       T05683                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
fki  Flavobacterium kingsejongi
Pathway
fki03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:fki00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    FK004_15155
Enzymes [BR:fki01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     FK004_15155
DNA repair and recombination proteins [BR:fki03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     FK004_15155
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C RNA_ligase mRNA_cap_enzyme DNA_ligase_OB_2
Motif
Other DBs
NCBI-ProteinID: AWG26464
UniProt: A0A2S1LRW0
LinkDB All DBs
Position
3329782..3332322
Genome map
AA seq 846 aa AA seqDB search
MKLERYNQKRDFTKTKEPKGVPKKSKNTLQFVVQKHAASHLHYDFRLEIDGVLVSWAVPK
GPSADPADKRLAVMTEDHPMAYLHFEGSIPAGEYGGGTVMVWDTGEYRPEGSEKPADDAR
MMMEQLKSGSIKVVLEGGKLKGAWHLVQMKSGKNWLLMKAKDEFSGDHVTFDENSILSQR
DFPEIEKEGVAWGEKKSNIQKPKTDSVAATNTAEFTADSLSGAVKLTRFPMDWRPQLATL
TDSVFDSEDWIFETKYDGYRALAQIQNNKADLISKNGNSFLSKYSTIAKALEQIHDDVIL
DGEIVVEDTKGTSHFQWLQHYEDTPEKGLLKFYIFDILYFNGYDLRGLELLQRKKILKAI
LPPLENCVYSTHVTTTGTALFQTIQKEGGEGIIAKKKSSTYHTDTRTKDWLKVKTTKEQE
MVIGGYTDPQGQRSGLGALLCGYYKDNAFVYSGKVGTGFSDNYLTALQKQLKKLEQPSCP
FSTPPKIQNVHWVSPKLVAQIKFSEWTESGNMRHPVFIALRSDKDPKTVVRETVQSKIKK
TPKTKMEKKAKPSEVQSDKVTFTNPDKVFWPDEKITKGAVISYYEQIAPYLLPFLKDRPQ
SLRRNPDGISKPGFFQKNVAGLVPDWIKTRKLKSKSTDETIEYLLCQDKDTLLFLANWGC
IELNPWSSRVGSINNPDYIIFDLDPNEADMEKLVATALKVKELLDRLKVTAYLKTSGGKG
LHIFIPVLPKYTYDQSRQFSHLISQMVHRELPDSTSLERSPDKRKGKIYLDFLQNGKGKT
MASVYSLRPRAGAPVSTPLEWEELHPKMDLKSYNIHTIIDRIATKGDLWKDFFEHKMDLK
TILASL
NT seq 2541 nt NT seq  +upstreamnt  +downstreamnt
atgaaattagaacgatacaatcaaaagcgtgattttacaaaaacgaaagagcctaaaggt
gttccgaagaaatccaaaaacaccttacagtttgtcgttcagaaacatgccgcctcccat
cttcattatgacttcaggctggaaattgatggggtactcgtcagttgggcagtacctaaa
ggcccttctgcggatcctgccgacaaaaggctggctgtaatgacggaagaccatcctatg
gcatacctccattttgaaggaagtatacctgccggagaatatggtggtggaactgtaatg
gtttgggatacgggcgaataccgccccgaaggttccgaaaagccagcagatgacgccaga
atgatgatggaacaactcaaatcaggatcaataaaagtggtattggaaggcgggaaactc
aaaggtgcctggcatttggtacaaatgaaatccgggaaaaactggcttttgatgaaagct
aaagatgagttctcgggtgatcacgttacatttgatgaaaattccatcctcagtcaaagg
gattttcctgaaattgaaaaagaaggtgttgcctggggtgaaaaaaaaagtaacatccag
aaaccaaaaactgattcagttgcagctacaaatacagctgaattcacagccgacagcctt
tcgggagctgtaaaacttacccgctttccgatggactggcgaccacaattagcaacactc
accgatagtgtttttgatagtgaagactggatttttgaaacgaaatatgacggataccgt
gcgctggcacaaatccaaaacaataaagcagacctgatttccaaaaatggcaattctttt
ctttccaaatacagcactatagccaaagccttggagcaaattcacgatgatgtcatcctt
gatggcgagattgtagtagaagataccaaagggactagccatttccaatggttacagcat
tatgaagacactcctgaaaaagggctgttgaagttttacatctttgatatcctctatttt
aatggatatgacctgagagggctggaattactgcagcgtaaaaaaatactaaaagccatt
ttaccaccacttgaaaactgcgtgtattccacccatgtaaccactaccggaacggcactt
tttcaaaccattcaaaaagaaggcggtgaaggtattattgcaaaaaagaaaagcagtacc
taccatactgatacacgaaccaaagactggctaaaagtaaaaacaaccaaggaacaggaa
atggtaattggcggatataccgacccacaagggcaacgctccggtttgggggccctgctt
tgcggctattataaagacaatgcttttgtctattccggaaaagtaggtacgggattttca
gacaactacctgactgccttacaaaagcagttaaaaaaactggaacagccctcctgcccg
tttagtacaccgccaaaaatccaaaatgtacattgggtaagcccaaaacttgtagcccaa
atcaaattttcagaatggactgaaagtgggaatatgcggcatcctgtttttatcgccctg
cgctcagacaaagatcccaaaacagtagttcgggaaacagtacaatcgaagatcaaaaaa
accccaaaaacaaaaatggaaaagaaagcaaaaccatccgaagtgcaatccgataaagta
acctttacgaatccggataaagtattctggccggacgaaaaaataaccaaaggtgctgtg
atttcctattatgaacagatagcaccttacctcctaccctttttaaaagaccgtccgcag
tcattacggaggaatccggatggaattagtaagcccggctttttccagaagaatgttgcc
ggtttggtaccggattggatcaagacccgaaaactaaaatcaaaaagtacagatgaaacc
attgaatacctgctttgccaggataaagataccctgcttttcctggccaactggggttgt
atcgaattaaatccctggagcagtcgtgtcgggagcattaataatcccgattatattata
ttcgatttagatcctaatgaggctgatatggaaaaattagtcgctacagcattaaaggta
aaggaactattagaccggctaaaagtcacagcctatcttaaaacttcgggcggcaaaggc
ctgcatatctttattccggtattgcctaaatacacctatgaccaaagccgtcagttttcg
cacctgatcagtcaaatggtacatcgtgaattgccggatagtaccagcctggaacgaagc
cccgataaacgaaaaggtaaaatctatctcgatttcctccaaaatggtaaaggcaaaaca
atggccagtgtctattctctccggccccgtgcgggtgctcctgtgagtacaccattggaa
tgggaagaactacacccgaaaatggaccttaaaagttataacatccataccatcatcgat
cgtatcgcgacaaaaggggatttgtggaaagatttctttgagcataaaatggatttgaag
actattttagcctctttataa

DBGET integrated database retrieval system