KEGG   Fusobacterium nucleatum subsp. nucleatum ATCC 25586: FN2107
Entry
FN2107            CDS       T00077                                 

Definition
(GenBank) Galactokinase
  KO
K00849  galactokinase [EC:2.7.1.6]
Organism
fnu  Fusobacterium nucleatum subsp. nucleatum ATCC 25586
Pathway
fnu00052  Galactose metabolism
fnu00520  Amino sugar and nucleotide sugar metabolism
fnu01100  Metabolic pathways
Module
fnu_M00554  Nucleotide sugar biosynthesis, galactose => UDP-galactose
fnu_M00632  Galactose degradation, Leloir pathway, galactose => alpha-D-glucose-1P
Brite
KEGG Orthology (KO) [BR:fnu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    FN2107
   00520 Amino sugar and nucleotide sugar metabolism
    FN2107
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:fnu04147]
    FN2107
Enzymes [BR:fnu01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.6  galactokinase
     FN2107
Exosome [BR:fnu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   FN2107
SSDB
Motif
Pfam: GalKase_gal_bdg GHMP_kinases_N GHMP_kinases_C
Other DBs
NCBI-ProteinID: AAL94191
UniProt: Q8RHD0
LinkDB
Position
618290..619459
AA seq 389 aa
MLENLIKDFKEIFKYSGEVERFFSPGRVNLIGEHTDYNGGFVFPCALDFGTYAVVKKRED
KTFKMYSKNFENLGIIEFNLDNLIYDKKDDWANYPKGVIKTFLDRNYKIDSGFDVLFFGN
IPNGAGLSSSASIEVLTAVILKDLFKLDVDIIEMVKMCQVAENKFIGVNSGIMDQFAVGM
GKKDNAILLDCNTLKYEYVPVKLVNMSIVIANTNKKRGLADSKYNERRTSCEEAVKVLNN
NEVNIKYLGELTVTEFEKVKHYITDEEQLKRATHAVTENERAKIAVEFLKKDDIAEFGKL
MNKSHTSLRDDYEVTGLELDSLVEAAWEEKGTVGSRMTGAGFGGCTVSIVENDYVDSFIK
NVGKKYKEKTGLEASFYIANIGDGAGKVK
NT seq 1170 nt   +upstreamnt  +downstreamnt
atgttagaaaatttaataaaagactttaaagaaatttttaaatatagtggggaagtggag
agatttttttcaccaggtagagtgaatttaattggtgaacacacagattataatggaggt
tttgttttcccttgtgccttagattttggaacttatgcagttgtcaaaaaaagagaagat
aaaacttttaaaatgtactctaagaattttgaaaatttaggaatcattgaatttaattta
gataatttaatctatgataaaaaagatgattgggctaactatccaaaaggagttattaaa
actttcttagatagaaactataaaatagatagtggttttgatgttttgttttttggaaat
attcctaatggtgcaggactttcttcatctgcctctattgaagttttaacagctgttata
cttaaagatttatttaaacttgatgttgacataattgaaatggttaagatgtgtcaagta
gcagaaaataaatttattggggtaaattcaggaattatggaccaatttgcagttggtatg
ggtaaaaaggacaatgctatcttactagattgtaatactttaaaatatgaatatgttcct
gtaaaattagtgaatatgtcaatagttattgctaacactaataaaaaaagaggtttagca
gactcaaaatacaatgaaagaagaacttcttgtgaagaagctgttaaagttttaaataat
aatgaggttaatattaagtatttaggggaacttactgttacagaatttgaaaaagttaaa
cactatataacagatgaagaacaattaaaaagagcgactcatgcagttactgaaaatgaa
agagctaaaattgcagttgaatttttgaaaaaagatgatattgcagaatttggaaaatta
atgaataaatctcatacctctttaagagatgattatgaagttacaggtttagaacttgat
agccttgtggaagctgcttgggaagaaaagggaactgttggttctcgtatgacaggagca
ggttttggaggttgtactgtaagcatagttgaaaatgactatgttgatagctttataaaa
aatgttggaaagaaatataaagaaaaaacaggtttggaagctagtttctatatagcaaat
attggagatggagcaggaaaggtgaaataa

DBGET integrated database retrieval system