KEGG   Falco peregrinus (peregrine falcon): 101910517Help
Entry
101910517         CDS       T02856                                 

Gene name
PFKP
Definition
(RefSeq) phosphofructokinase, platelet
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg00010  Glycolysis / Gluconeogenesis
fpg00030  Pentose phosphate pathway
fpg00051  Fructose and mannose metabolism
fpg00052  Galactose metabolism
fpg01100  Metabolic pathways
fpg01200  Carbon metabolism
fpg01230  Biosynthesis of amino acids
fpg03018  RNA degradation
Module
fpg_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    101910517 (PFKP)
   00030 Pentose phosphate pathway
    101910517 (PFKP)
   00051 Fructose and mannose metabolism
    101910517 (PFKP)
   00052 Galactose metabolism
    101910517 (PFKP)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    101910517 (PFKP)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:fpg01009]
    101910517 (PFKP)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:fpg03019]
    101910517 (PFKP)
Enzymes [BR:fpg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     101910517 (PFKP)
Protein phosphatases and associated proteins [BR:fpg01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     101910517 (PFKP)
Messenger RNA biogenesis [BR:fpg03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     101910517 (PFKP)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: PFK
Motif
Other DBs
NCBI-GeneID: 101910517
NCBI-ProteinID: XP_005233985
LinkDB All DBs
Position
Un
AA seq 784 aa AA seqDB search
MDHQPKFFENLSGTGKAIGVLTSGGDAQGMNAAVRAVVRMGIYVKAKVYFVYEGYQGMVD
GGDNIVEVSWESVSSILQVGGTVIGSARCKSFRTREGRLQAAYNLVQRGITNLCVIGGDG
SLTGANLFREEWSGLLEELAQKGKIDEEAVKKYAYLNIVGMVGSIDNDFCGTDMTIGTDS
ALHRIIEVVDAIMTTAQSHQRTFVLEVMGRHCGYLALVSALACGADWVFIPEYPPEEGWE
DSMCVKLSENRARKKRLNIIIVAEGAIDCHNKPITSEKVKDLVVQRLGFDTRVTILGHVQ
RGGTPSAFDRILASRMGVEAVLALLEATPATPACVVSLSGNQAVRLPLMECVQMTQEVQK
AMDEGRFVEAVRLRGRSFENNLNTYKLLSHKKPDAELPKTNFNVAVLNVGAPAAGMNAAV
RAAVRVGITEGHKMFAVIDGFEGFARGKIKEISWGDVGGWTGQGGSILGTKRTLPAKYLE
KIADQMRTNNINALMVIGGFEAYLGLLELSAAREKYDEFCVPMVMVPATVSNNVPGSDFS
IGADTALNTITDTCDRIKQSASGTKRRVFIIETMGGYCGYLANMGALAAGADAAYIFEEQ
FDIRELQANVEHLTEKMKTSIQRGLVLRNENCNENYTTDFIYQLYSEEGKGVFDCRKNVL
GHMQQGGAPSPFDRNFGTKISAKAMQWISKKLKETYRKGKVFANTDDSVCLLGMRRRNLV
FQPVAELKTETDFVHRIPKEQWWLKLRPLMKILAKYKTSYDVSDSGQLEHVAMHSPKEAE
TGAI
NT seq 2355 nt NT seq  +upstreamnt  +downstreamnt
atggatcaccagccaaagttcttcgagaacctctcgggcaccgggaaggccatcggggtg
ctgaccagcggcggcgatgcccaaggtatgaatgctgctgtgcgcgcagtagtacgcatg
ggaatctatgtaaaagccaaagtgtattttgtttatgagggttaccagggaatggttgat
ggaggtgataatattgtagaagtttcatgggaaagtgtttcaagtatcctacaagtggga
ggtacagttattggtagtgcacgctgcaaatcttttcgtacccgtgagggccgcctgcag
gcagcctacaacttggttcaaagaggaatcactaatctttgtgtgattggcggagatggt
agcttaaccggtgcaaatctgttccgtgaagaatggagcggacttctagaagaactggcg
cagaaaggaaagattgatgaagaggctgttaagaagtatgcttaccttaacattgtggga
atggttggatccatagataatgacttctgtggcactgatatgaccataggtactgactca
gccttgcacagaatcattgaagttgtggatgccattatgaccactgctcaaagccatcag
aggacatttgttctggaggttatggggagacactgtgggtatctagctcttgttagtgcc
ttagcctgtggtgcagattgggtatttattcctgaatacccaccagaagaaggatgggaa
gattcaatgtgtgttaagctctcagagaatcgtgcacgaaagaaaaggctgaatattatt
attgtagctgaaggagctattgactgccacaacaaacctataacgtcagagaaggttaag
gatcttgtggttcagcgacttggttttgacacccgagtaactatcttgggtcatgtgcaa
agaggtggaaccccttcagcttttgacagaattttggcaagtcgtatgggtgtggaagct
gtgcttgcccttttagaagctactccagctacccctgcctgtgttgtgtccctgtctgga
aaccaggctgtccgtctgcctttgatggagtgtgtgcagatgactcaagaagtccagaaa
gccatggatgagggaagatttgttgaggctgtgaggcttcgtggaaggagctttgaaaac
aaccttaacacctacaaattgctgtcgcacaaaaaaccagacgctgagcttccaaagact
aattttaatgtggcagttttaaatgttggtgcccctgcagctggaatgaatgctgcagtg
agggctgcagtgagagttggcataactgaaggccataaaatgtttgctgtcattgatgga
tttgaaggttttgctagagggaagataaaggaaatcagctggggagatgttggaggctgg
actggtcaaggaggatcaattcttggtacaaaacgtactcttcctgcaaaatatttggag
aagattgctgaccagatgcgcactaacaacattaacgcccttatggttattggtggattt
gaggcgtaccttggacttctggaattgtcagctgcccgagagaaatatgacgaattctgt
gttccaatggttatggttcctgcaactgtatccaacaatgtaccgggttcagatttcagc
attggtgcagatactgctctgaacactatcactgatacatgtgatcgcatcaaacaatca
gccagtggtaccaagcgtcgtgttttcatcattgagaccatgggtggttattgtggttat
ctggctaatatgggggcccttgcagcaggagctgatgctgcttatatctttgaagaacag
tttgatattcgagagctccaggctaacgtggaacacttgactgaaaaaatgaaaaccagt
atccagcgtggtctagtgctgagaaacgagaactgcaatgagaattacacaactgacttc
atttatcagctgtattctgaagaaggaaagggagtgtttgactgtcgaaagaatgtactg
ggccacatgcaacagggcggtgcaccttcaccatttgataggaacttcgggacaaagatt
tctgcaaaagctatgcagtggatctccaaaaaactgaaagaaacctaccgaaaaggaaaa
gtatttgccaatactgatgactctgtctgtttgctgggaatgcgtagacgcaaccttgtt
ttccaaccagtggctgagctcaagactgaaacagactttgtacacaggattcccaaggag
caatggtggctgaagctgcgacccctgatgaaaatcctggccaagtacaagactagttac
gatgtttcagattcaggccagctggagcatgttgctatgcacagcccaaaggaagcagaa
actggagccatctaa

DBGET integrated database retrieval system