KEGG   Falco peregrinus (peregrine falcon): 101911274
Entry
101911274         CDS       T02856                                 

Gene name
SPOP
Definition
(RefSeq) speckle type BTB/POZ protein
  KO
K10523  speckle-type POZ protein
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    101911274 (SPOP)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:fpg04121]
    101911274 (SPOP)
Ubiquitin system [BR:fpg04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     101911274 (SPOP)
SSDB
Motif
Pfam: BTB MATH BACK
Other DBs
NCBI-GeneID: 101911274
NCBI-ProteinID: XP_005235910
LinkDB
Position
Un
AA seq 374 aa
MSRVPSPPPPAEMSSGPVAESWCYTQIKVVKFSYMWTINNFSFCREEMGEVIKSSTFSSG
ANDKLKWCLRVNPKGLDEESKDYLSLYLLLVSCPKSEVRAKFKFSILNAKGEETKAMESQ
RAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQNTMNMVK
VPECRLADELGGLWENSRFTDCCLCVAGQEFQAHKAILAARSPVFSAMFEHEMEESKKNR
VEINDVEPEVFKEMMCFIYTGKAPNLDKMADDLLAAADKYALERLKVMCEDALCSNLSVE
NAAEILILADLHSADQLKTQAVDFINYHASDVMETSGWKSMVVSHPHLVAEAYRSLASAQ
CPFLGPPRKRLKQS
NT seq 1125 nt   +upstreamnt  +downstreamnt
atgtcaagggtgccgagtcctcctcctccggcagaaatgtcgagtggacctgtagcagag
agctggtgctacactcagatcaaggtggtgaagttttcctacatgtggaccataaacaac
tttagcttctgccgagaagaaatgggtgaggtcatcaaaagctcaacattttcatctgga
gccaatgataagctcaaatggtgtttacgtgtgaaccctaaaggcttggatgaagaaagt
aaagattatctatccctttatctgttgctggtgagctgtccaaaaagtgaagttcgagca
aagttcaaattctccatcctgaatgctaaaggagaagaaacaaaagcaatggagagccag
cgagcatatcgatttgtacaaggcaaggactgggggttcaaaaaatttattagaagagac
tttcttttggatgaggccaatggacttcttccagatgacaaactcactctcttctgcgag
gtgagcgtggtacaggactctgtcaatatctctggccagaacactatgaacatggtgaag
gtaccagagtgccgcttggcagatgagttgggaggactctgggagaattcacgcttcacg
gactgctgcctgtgtgttgcgggccaggagttccaggctcacaaagccatactggcagca
cgttccccagttttcagcgccatgtttgagcatgagatggaggagagtaaaaagaatcgg
gttgaaatcaatgatgtggagcccgaagtttttaaggaaatgatgtgctttatttacacg
gggaaggcaccaaatcttgacaaaatggccgatgacttgctggcagctgctgacaagtat
gctctagaacgtctgaaggtgatgtgtgaggatgcactgtgcagtaacctgtctgtggaa
aatgcagcagagatcctcattctagctgacctacatagtgctgatcaactaaaaactcaa
gcagtggacttcattaactatcatgcttctgacgtcatggagacatcaggctggaagtct
atggtagtgtcgcatccccatttggtggctgaggcatatcgctcattggcttctgcacag
tgtccctttctgggacctccacgtaaacgactgaagcaatcctaa

KEGG   Falco peregrinus (peregrine falcon): 101917004
Entry
101917004         CDS       T02856                                 

Gene name
SPOPL
Definition
(RefSeq) speckle type BTB/POZ protein like
  KO
K10523  speckle-type POZ protein
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    101917004 (SPOPL)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04121 Ubiquitin system [BR:fpg04121]
    101917004 (SPOPL)
Ubiquitin system [BR:fpg04121]
 Ubiquitin ligases (E3)
  Multi subunit Ring-finger type E3
   Cul3 complex
    Adoptor and target recognizing subunit (BTB)
     101917004 (SPOPL)
SSDB
Motif
Pfam: BTB MATH
Other DBs
NCBI-GeneID: 101917004
NCBI-ProteinID: XP_005242418
LinkDB
Position
Un
AA seq 392 aa
MSRVPTPPPPGEMSSGPVAESWCYTQVKVVKFSYMWTINNFSFCREEMGEVLKSSTFSSG
PNDKMKWCLRVNPKGLDDESKDYLSLYLLLVSCPKSEVRAKFKFSLLNAKREETKAMESQ
RAYRFVQGKDWGFKKFIRRDFLLDEANGLLPDDKLTLFCEVSVVQDSVNISGQSNTNTLK
VPECRLAEDLGNLWETTRFTDCSFYVGGQEFKAHKSVLAARSPVFNAMFEHEMEESKKNR
VEINDVDPEVFKEMMRFIYTGKAPNLEKMADNLLAAADKYALERLKVMCEEALCSNLSVE
NVADILILADLHSAEQLKAQAIDFINRCSVLRQLGCKDGKNWNSNQATDIMETAGWKSMI
HSHPHLVAEAFRALASAQCPQFGIPRKRLKQS
NT seq 1179 nt   +upstreamnt  +downstreamnt
atgtcaagggttcctaccccacctcctcctggggagatgtccagtggacctgtggctgaa
agctggtgttacacacaggttaaagtagtaaaattttcctacatgtggaccattaataac
ttcagtttttgtcgagaagaaatgggtgaagttttaaagagctctaccttttcatcaggg
ccaaatgacaaaatgaagtggtgcctgagagtgaatccaaagggattagatgatgaaagt
aaagactacctgtcactatatttgcttttagtcagttgtccaaaaagtgaagtcagagca
aaattcaaattttccctgctgaatgcaaaaagagaagaaacaaaagcaatggaaagccaa
agagcatatcgatttgtgcaaggcaaggactggggttttaagaaatttatccgaagagat
tttttactagatgaagctaatggtcttctaccagatgacaagcttacattattttgtgag
gtaagcgtggtccaagactcagtaaatatatcaggacagtctaatacaaacactttgaag
gtacctgaatgtcgactagcagaagatttagggaatctctgggaaacaacaagatttaca
gattgcagtttttatgtaggaggacaagaattcaaagctcataaatctgtccttgcagca
cgatctccggtttttaatgcaatgtttgagcatgaaatggaggaaagcaaaaagaatcgt
gtagaaataaatgatgtagaccctgaagtttttaaagaaatgatgagattcatttacaca
ggaaaagcaccaaaccttgaaaaaatggctgacaatttgttggcagctgcagacaaatat
gcactggaacggctgaaggtcatgtgtgaggaagcactgtgtagtaacctctcggtagaa
aatgttgctgacattcttatcctcgcagatttgcacagcgctgaacagttaaaagcacaa
gcaatagactttattaacaggtgcagtgttcttagacaacttgggtgtaaagatgggaaa
aactggaatagcaaccaagcaacagacataatggaaacagcaggttggaagtccatgatc
cactcccaccctcacttagtagcagaggcctttcgcgcactagcatctgcacagtgtcca
cagtttggcattccacgcaaacggctaaaacagtcatga

DBGET integrated database retrieval system