KEGG   Falco peregrinus (peregrine falcon): 101915784
Entry
101915784         CDS       T02856                                 

Gene name
KIF7
Definition
(RefSeq) kinesin family member 7
  KO
K18806  kinesin family member 7
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04340  Hedgehog signaling pathway
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04340 Hedgehog signaling pathway
    101915784 (KIF7)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04812 Cytoskeleton proteins [BR:fpg04812]
    101915784 (KIF7)
Cytoskeleton proteins [BR:fpg04812]
 Eukaryotic cytoskeleton proteins
  Microtubules
   Tubulin-binding proteins
    Kinesins
     101915784 (KIF7)
SSDB
Motif
Pfam: Kinesin Microtub_bd
Other DBs
NCBI-GeneID: 101915784
NCBI-ProteinID: XP_013153842
LinkDB
Position
Un
AA seq 1353 aa
MALWCLTEGIASSINEDEQGIIPRAMAETFKLIDENDLIDYTVRVSYLEVYKEEFRDLLQ
ADTASKDIQIREDDKGNVVLCGVKESEVEGLDEVLSLLEMGNTAKHTGATHVNRQSSRSH
TIFTVTMEQRRGAGRLPLHHHPSSVPASGQVLVSKFHFVDLAGSERIVKTGNTGERLKES
IQINSGLLALGNVISALGDPRRKSSHIPYRDSKITRILKDSLGGNAQTVMIACVSPSSSD
FDESLNTLNYANRAQNIQNKAVVNCRKETEHVEELHLQIKKLQKALEQRHRSETRIINRS
ATTKRCVPEPTARLLAECAHYRTCTDAAYRLLMELQEDSNLTVEQILRVKEWLCAVESER
SELTSAGLDSGIESTSAEEQSLEAQGSKLARAQGQVNTEKRCEPIKDEQVAKLQRQVERL
EEENRDFLAALEDAMEQYKLQSDKLREQQDKISELHVRLEMAMPNLCVPGLLENLHLVTA
GQRPHTAPLDAAPSHGLSGVPSGLLPAEQSGRARCRKHLDSDPSFQEEDLASWHLNHAQC
LTGNPEVRDAVLRRELSQDLEKPSELSSGEEEEEWEQKRSLLQRRNGIQSWSKKDICKLK
EEPSGDNAHSIQEEQLELSKEVCRKREPVLGPWERLPGKDSEWRLVQAQQKIRELAINIR
MKEELITELIKTGKDAQALNRQYCQKIGELEQEAEQVRAELSDSQKQLQELEGKETWDPG
EKHKLQEYRTRVAAAQSKARVLCKKKQATERLVSLSAQSEKRVQELERNIQLMRRQQGQL
QRRLREESEQKRRLEMEVNKRQHRVKELELKHEQHQKILRIKTEEIAAFQRKRRSGSNGS
VISLEQQQKIEEQKKWLDMEMDKVLEQRRALDELEDELRKREAIVAKKEALLQEKNGLES
KRLRSSQALTDDIVRVSSRLEHLEKELTEKNGQLRHGSAHDQQQIRHEINNLRQEKDQLL
KQRLELDNKLRHGTLLSPEVPLLGLGCAACNGCSPTSSGCAXPNFLPASLRXCXDDKGRL
GQSEAGRTVCSLVTAALPWQEERILFQLDEAIEALDAAIEYKNESITCRQRVLRASASLL
SQCEMNLMAKLSYLSSSETRALLCKYFDKVVTLREDQHRQHIAFSELEMQLEEQQQLVYW
LEAAVERQRLEMDRQLTLQQKEHEQNMQLLLQQSREHMDEGLASSKLQYEARIQVLEKEL
SHYMWANQELNQRLSNMNLHPGQTKAGMERGIHGAGDRAAPALGTCEESSLGEQPVPLAV
PEESHRVRDENRDLVHAPLPSTWRRSSLPNDSPGDLRQRDPEHLLRAGQPHEVHPPRSLA
PASKPRRELRRASLNVTAVPYHPAMIDVRKNPL
NT seq 4062 nt   +upstreamnt  +downstreamnt
atggcgttatggtgtcttacagagggcatagcttcttccatcaatgaagacgagcagggc
atcatcccacgagccatggctgagactttcaagcttattgatgagaatgacctgattgac
tacacggtccgagtgtcctacctggaagtgtacaaggaggagtttcgggacttactgcag
gcggatacagccagcaaagacatccagatccgggaggatgacaaggggaatgtcgtgctc
tgcggtgtgaaggagtcagaagtggaagggctggacgaggtgctgagcctgctggagatg
gggaacacagccaagcacacgggagctacccatgtcaacaggcagtcgagccgctcacac
accatcttcacggtgaccatggaacagcggcgtggggctggccgcctccccctgcaccac
cacccctcctctgtccctgcctcgggccaggtcctggtttccaagtttcactttgtggac
ctggcaggctcagagcgaattgtgaagacgggaaacacaggggagaggctgaaggagagt
atccagatcaacagtggcctcctggccttaggcaatgtcatcagcgccttgggagaccct
cggaggaagagcagccacatcccctacagggactccaaaatcaccaggatcctgaaagac
tctctgggagggaatgcccagactgtgatgatagcctgtgtcagcccatcctcctccgac
ttcgatgagagcctcaacacgctgaattatgccaaccgggctcaaaacatccagaacaag
gccgtggtgaactgccgcaaggagacggagcacgttgaagagcttcacctgcaaataaag
aagctgcagaaggcgctggaacagcggcaccgctccgagacccgtatcatcaaccgctcg
gccaccaccaaacgatgcgtgccggagcccacggctcggctgctggctgagtgcgcgcat
taccgcacctgcaccgatgctgcgtaccggctgctgatggagctgcaggaggacagcaac
ctgacggtggagcagatcctgcgggttaaggagtggctgtgcgcggtggagagcgagagg
agtgagctgacctcggccgggctggatagcggtatcgagagcacctccgcagaggagcag
agcctcgaggcacaaggctcaaagctggcaagagcccagggacaggtgaacactgagaag
aggtgtgaacccatcaaagatgagcaggtggctaaactgcagaggcaagtggagcgcctg
gaggaggagaaccgtgatttcctggctgccctggaggatgccatggagcagtataagctg
cagagcgacaaactgcgggagcagcaggataagatctctgagctgcacgtgcgccttgag
atggcaatgccaaacctgtgtgtgccagggctgctggaaaaccttcacttggtgactgct
ggccagagacctcacacagccccgctggacgctgccccgtcccatggcctcagtggggtt
ccctcggggctccttcccgctgagcagagtggaagagcccgttgcaggaagcatcttgac
agcgacccctccttccaggaggaggacctggccagctggcacctgaaccatgcgcagtgc
ctgactggcaatccagaggtcagagacgcggtgctgaggagggagcttagccaggacttg
gagaagccatcagagctgtcctcaggagaggaggaggaggagtgggaacagaaacggtcc
ctgttgcagcgccgaaatgggatccaaagctggagcaagaaggacatctgcaagttgaag
gaggagccgagtggagacaatgctcactcgattcaggaggagcaactggagctgtcaaaa
gaggtctgtagaaagcgggagccagtgcttggtccctgggagcgcctgccagggaaggac
tcggagtggaggctggtgcaagcacagcagaagatccgggagctggcgatcaacatccgc
atgaaggaggagctgatcacggagctcattaagacaggcaaggacgcccaggctctgaac
aggcagtactgccagaagatcggcgagctggagcaggaggcagagcaggtgcgggcagag
ctgagtgacagccagaagcagctccaggagctggagggcaaagagacgtgggaccccggg
gagaagcacaagctgcaggagtaccgcacacgtgtggcggctgcgcagagcaaggcacgg
gttctctgcaaaaagaagcaggcgacggagaggctggtgtccctctcagcccagagcgag
aaacgggtgcaggagctggagaggaacattcagctgatgcggcggcagcagggccagctg
cagcgccggctgcgggaggagagtgagcagaaacggcggctggagatggaggtgaataag
cggcagcaccgagtcaaggaactggaactgaagcatgagcagcaccagaaaatcctgcgc
atcaaaacagaggaaattgcagctttccagaggaagcggcggagtggcagcaacggctcc
gtgatcagcctggagcagcagcagaaaattgaggaacagaagaagtggctggacatggag
atggataaagttctcgagcaacgccgggccctggatgagctagaagatgagctgaggaag
cgggaagctattgtggccaaaaaggaagccctgctgcaggagaagaacggcctggagagc
aagcgactgcgctccagccaggctctgacagatgacatagtgcgtgtgtccagccgcctg
gagcacctagaaaaggagctgactgagaagaacgggcagttgcgtcacggcagtgcccat
gaccagcagcagatccgccacgagatcaacaacctgcgccaggagaaggaccagctgctc
aaacagaggttggagctcgacaacaagctgcgtcacggcaccctgctgtccccagaggta
cctcttcttgggctgggctgcgctgcttgcaatggatgctcccccacgtcctcaggctgt
gcgtagcccaacttcttgccggcatcattgagatgatgctgagatgacaaggggaggtta
gggcagagtgaggcagggcgaaccgtttgctccctggtaactgcagctctgccctggcag
gaagaacggatcttgttccagctggacgaggcaatcgaggccctggatgcagccatcgag
tacaagaatgagtctatcacgtgcaggcaacgagtcctgcgggcctcagccagcctgctg
tcccagtgtgagatgaacctcatggccaagctcagctacctctcctcctccgagacccgc
gctctgctctgcaaatactttgacaaggtggtgacactgcgagaggatcagcacaggcaa
cacattgccttctcagagctggagatgcagctggaggagcagcagcagctggtgtactgg
ctggaggcggccgtggaacgtcagcgcctggagatggaccgccagctcaccctgcagcag
aaggagcatgagcagaacatgcagttactgctccagcagagccgtgagcacatggatgag
gggctggccagcagcaagctgcagtatgaggccaggattcaggtgctggaaaaggagctg
agccattatatgtgggcaaaccaggagctgaaccagaggctgagtaacatgaacctccat
cctggacagaccaaagcagggatggagagaggcattcacggggctggggacagagctgcc
cctgccctcgggacctgtgaggaatccagccttggggagcagcccgtgcctctggccgtc
cctgaagaaagccatcgggtcagggatgagaacagggacctggtgcatgcccctttgcca
tcgacatggaggcgttcctccctgcccaacgacagtcctggggaccttcggcagagggat
ccggagcacttgctgagagcggggcagcctcatgaggtgcacccaccacggagcctggct
cctgcctccaagccccgccgggagctgcgcagagccagcctgaacgtgaccgccgtgcct
taccacccagcgatgatagatgtgaggaaaaacccactctag

DBGET integrated database retrieval system