KEGG   Falco peregrinus (peregrine falcon): 101919862Help
Entry
101919862         CDS       T02856                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin-endoperoxide synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg00590  Arachidonic acid metabolism
fpg01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    101919862 (PTGS1)
Enzymes [BR:fpg01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     101919862 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF hEGF
Motif
Other DBs
NCBI-GeneID: 101919862
NCBI-ProteinID: XP_005231350
LinkDB All DBs
Position
Un
AA seq 613 aa AA seqDB search
MVSLINSAFLAVGSCGQSGCWRQLGMAAGTASHGGSVNPCCYFPCQHQGVCVRVGLGGYE
CDCTRTGYFGINCSSPELWTRLYNVLKPSPAFYHFILTHFRWVWDIINSTFIRDTLMRLV
LTVRANLIPSPPTFNSDYGYISWEAYANVSYYTRILPPVPDSCPTPMGTKGKQQLPDPQL
LAERFLLRQKFEADPRGTNLMFAFFAQHFTHQFFKTSGKMGRGFTKALGHGVDLGHLYGD
NLQRQHQLRLFRDGKLKFQVVDGEVYPPTVTDAPVHMVYPSAIPKEKQLAMGQEVFGLLP
GLCMYATLWLREHNRVCDILKQEHPTWSDEQLFQTARLILIGETIKIVIEDYVQHLSGYY
LSLKFDPELLFGTQFQYRNRIAVEFNQLYHWHGLMPDSFIIQGEEYSYDQFLYNTSMLMD
YGVEALVESFSKQAAGRIGGGQTINANVLKVAIGVIKESRQLRLRPFNEXXXXXXXXXXR
KRFGMKPYRSFQELTGEEENAAELEELYGDIDALEFYPGLLLEKPQPNGIFGESMVEIGA
PFSLKGLLGNPICSPEYWKPSTFGGATGFEIVKTASLKKLVCLNVKKCPYVAFHVPDAAE
HDSPRAGGSYAEL
NT seq 1842 nt NT seq  +upstreamnt  +downstreamnt
atggtttcactgataaactcagcttttctggctgttggcagctgtgggcagtctggctgc
tggcgccagctgggcatggctgccggcacagcttcccacggcgggtcagtgaatccctgt
tgctatttcccctgccagcaccaaggggtgtgcgtgagggtcggcctgggaggatacgag
tgtgactgcacgcggacgggatacttcggcatcaactgcagctcccccgagctctggaca
cgcctctacaacgtgctgaagcccagtcctgccttctaccacttcatcctgacccacttc
aggtgggtttgggacattatcaacagcaccttcatcagggacacgctcatgaggcttgtg
cttacagttcgtgccaatctcatccccagcccccccacgttcaactctgactacggctac
atcagctgggaggcctatgccaacgtcagctattacacccgcatcctcccgcccgtgccg
gacagctgcccgacgcccatggggaccaaagggaagcagcagctccccgacccccagctc
ctggcggagaggttcctgctgcggcagaagtttgaagctgatccccgaggcaccaacctg
atgtttgctttcttcgcccagcatttcacccaccagttcttcaagacgtccgggaagatg
ggacgcggcttcaccaaggcgctggggcatggggtggacctggggcacttgtacggggac
aacctgcagcggcagcaccagctgcgactcttcagagatgggaagctgaaattccaggtg
gtggatggagaggtgtacccccctacggtcaccgatgctcccgttcacatggtctacccg
tctgccatccccaaggagaagcagctggcgatggggcaggaggtgttcgggctgttgcca
gggctctgcatgtatgccacgctctggctgcgcgagcacaaccgcgtctgcgacatactg
aagcaggagcatcccacctggagcgatgagcagctcttccagacagctcgcctcatcctc
atcggggagaccattaagatcgtcattgaagactatgtccagcacctcagcgggtactac
ctgagcctcaagtttgaccctgagctgctgtttgggacacagttccagtaccggaatcgc
atcgcagtggagttcaaccagctctatcactggcacgggttgatgcccgactccttcatc
atccagggggaagagtacagctacgaccagttcctgtacaacacctccatgctcatggac
tatggcgtggaggcgctggtggagtccttttccaagcaggctgcaggaaggatcggtggg
ggacaaaccatcaatgccaatgtcttgaaagtggccattggggtcatcaaggaatcccgg
cagctgaggctacggccgttcaacgagtnnnnnnnnnnnnnnnnnnnnnnnnnnnnncgg
aagagatttggcatgaagccctacaggtcctttcaggagctgacaggagaggaagagaat
gcagcagagctggaagagctgtacggagacattgatgctctggagttctatccaggctta
ctgcttgagaaaccccaacccaatggtatttttggggaaagcatggtggagattggagct
ccgttttccctgaaggggcttcttggaaaccccatctgctccccagagtactggaaaccc
agtacatttggcggagcaactggctttgagatagttaagacagcatcactcaagaagctt
gtgtgcctcaatgtgaagaagtgcccgtacgttgcgtttcatgtgccagatgctgcggaa
catgacagccctcgggctggtggatcatatgctgagctctag

DBGET integrated database retrieval system