KEGG   Falco peregrinus (peregrine falcon): 101921803Help
Entry
101921803         CDS       T02856                                 

Gene name
PRKACB
Definition
(RefSeq) protein kinase cAMP-activated catalytic subunit beta
  KO
K04345  protein kinase A [EC:2.7.11.11]
Organism
fpg  Falco peregrinus (peregrine falcon)
Pathway
fpg04010  MAPK signaling pathway
fpg04020  Calcium signaling pathway
fpg04114  Oocyte meiosis
fpg04140  Autophagy - animal
fpg04261  Adrenergic signaling in cardiomyocytes
fpg04270  Vascular smooth muscle contraction
fpg04310  Wnt signaling pathway
fpg04340  Hedgehog signaling pathway
fpg04371  Apelin signaling pathway
fpg04530  Tight junction
fpg04540  Gap junction
fpg04910  Insulin signaling pathway
fpg04912  GnRH signaling pathway
fpg04914  Progesterone-mediated oocyte maturation
fpg04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:fpg00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    101921803 (PRKACB)
   04310 Wnt signaling pathway
    101921803 (PRKACB)
   04340 Hedgehog signaling pathway
    101921803 (PRKACB)
   04371 Apelin signaling pathway
    101921803 (PRKACB)
   04020 Calcium signaling pathway
    101921803 (PRKACB)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    101921803 (PRKACB)
  09143 Cell growth and death
   04114 Oocyte meiosis
    101921803 (PRKACB)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    101921803 (PRKACB)
   04540 Gap junction
    101921803 (PRKACB)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    101921803 (PRKACB)
   04912 GnRH signaling pathway
    101921803 (PRKACB)
   04914 Progesterone-mediated oocyte maturation
    101921803 (PRKACB)
   04916 Melanogenesis
    101921803 (PRKACB)
  09153 Circulatory system
   04261 Adrenergic signaling in cardiomyocytes
    101921803 (PRKACB)
   04270 Vascular smooth muscle contraction
    101921803 (PRKACB)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:fpg01001]
    101921803 (PRKACB)
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:fpg03019]
    101921803 (PRKACB)
   03036 Chromosome and associated proteins [BR:fpg03036]
    101921803 (PRKACB)
Enzymes [BR:fpg01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     101921803 (PRKACB)
Protein kinases [BR:fpg01001]
 Serine/threonine kinases: AGC group
  PKA family
   101921803 (PRKACB)
Messenger RNA biogenesis [BR:fpg03019]
 Eukaryotic Type
  mRNA surveillance and transport factors
   mRNA cycle factors
    Common to processing body (P body) and stress granule
     101921803 (PRKACB)
Chromosome and associated proteins [BR:fpg03036]
 Eukaryotic Type
  Centrosome formation and ciliogenesis proteins
   Kinases and associated factors
    101921803 (PRKACB)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Pkinase Pkinase_Tyr Kinase-like Haspin_kinase
Motif
Other DBs
NCBI-GeneID: 101921803
NCBI-ProteinID: XP_005238508
LinkDB All DBs
Position
Un
AA seq 398 aa AA seqDB search
MAAQKEVPCNQCTGTATALQRLEGFANRLFHRHSKSGVHEQRTALENESHHCSELAVLWD
KSMKEFLAKAKEDFLRKWESPPQNTAGLDDFERQKTLGTGSFGRVMMVKHKSTEQYYAMK
ILDKQKVVKLKQIEHTLNEKRILQAVNFPFLVKLEYSFKDNSNLYMVMEYVPGGEMFSHL
RRIGRFSEPHARFYAAQIVLTFEYLHSLDLIYRDLKPENLLIDQQGYIQVTDFGFAKRVK
GRTWTLCGTPEYLAPEIILSKGYNKAVDWWALGVLIYEMAAGYPPFFADQPIQIYEKIVS
GKVRFPSHFSSDLKDLLRNLLQVDLTKRYGNLKNGVNDIKNHKWFATTDWIAIYQRKVEA
PFIPKCRGPGDTSNFDDYEEEDIRASLTEKCAKEFADF
NT seq 1197 nt NT seq  +upstreamnt  +downstreamnt
atggcagctcagaaggaggtaccttgtaaccagtgcacagggacggccacagcactgcag
agactggaaggttttgctaatcgccttttccataggcattcgaagagtggtgtgcatgaa
cagagaacggctctggaaaatgagagccatcattgctctgaacttgctgtcctatgggac
aaatcaatgaaagagttcctagccaaagccaaagaagactttttaagaaaatgggaaagc
ccccctcagaatactgctggcctagatgattttgagaggcaaaaaacccttggaacagga
tcatttgggagagttatgatggtgaaacataaatccacagagcagtattatgctatgaag
atactggacaaacagaaggtcgtcaaactgaagcaaatagaacacacactgaatgagaag
agaatattacaagcagtgaactttcctttccttgtaaaactggagtattcttttaaggac
aattctaatttatacatggtaatggagtatgttcctggtggtgagatgttttcacatcta
agaagaatcggaaggttcagtgaaccacatgcacggttttatgcagctcagatagtgcta
acatttgagtacctccattcattagacctcatctacagagatctaaagcctgaaaatctt
ttaattgatcagcaaggatacatccaggtcacggactttggctttgcaaaaagagtaaaa
ggaagaacttggacgttatgtgggactccagaatacctggcacctgaaataattctcagc
aagggttacaacaaggcagtggattggtgggcattaggagtgttaatctatgaaatggca
gctggatatcccccattctttgcagatcagcccattcaaatttatgagaagattgtgtct
ggcaaggtaaggttcccatcacacttcagttcagacctaaaggatcttctaagaaattta
ctccaggtagatttgaccaaacggtatggaaatctcaagaatggtgtaaatgacataaag
aatcacaagtggtttgcaactacagattggattgccatttatcagagaaaggtagaggct
ccgttcataccaaagtgcagaggccctggagataccagcaactttgatgactatgaagaa
gaagatattcgtgcgtctctaacagaaaaatgtgcaaaagaatttgctgatttttag

DBGET integrated database retrieval system