KEGG   Flavobacterium psychrophilum 950106-1/1: IB65_01020Help
Entry
IB65_01020        CDS       T03412                                 

Definition
(GenBank) amino acid permease
  KO
K03294  basic amino acid/polyamine antiporter, APA family
Organism
fpq  Flavobacterium psychrophilum 950106-1/1
Brite
KEGG Orthology (KO) [BR:fpq00001]
 09190 Not Included in Pathway or Brite
  09193 Unclassified: signaling and cellular processes
   99977 Transport
    IB65_01020
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_permease_2 AA_permease AA_permease_C
Motif
Other DBs
NCBI-ProteinID: AIT64541
UniProt: A0A4Y4KYD4
LinkDB All DBs
Position
229246..230724
Genome map
AA seq 492 aa AA seqDB search
MSIWKKKSISLLLAEASESEKGLKRTLTAWSLVALGVGAIIGAGLFVRTATAAAQNAGPS
VTIAFIIAAIGCALAGLCYAELSSSIPISGSAYTYTYATMGELLAWIIGWDLILEYAVGA
ATVGIAWSEYLNNLLVNVLHTSPIPYSLSHSPFQISASGEHGIINLPAFFIVAVISLLLI
KGTQESAFVNGIIVLVKVSIVIMIIVFGWNFINPINHTPYIPQPSIFIDDSGVGHNYGGI
MGILGAAGTVFFAFIGFDAVSTAAQETKNPKRDMPIGILGSLAVCTVLYILFAHVLTGLE
SVEFFRTSGKEASVANVITTAMVGYEWLAQFVTVAILFGFTSVILVMLLGQSRVFYAMGK
DGLLPKAFGDLHSKYKTPYKANLVILVIVGAFAAFVPGDIVGDMTSIGTLFAFILVCVSV
IVLRKTDPDMKREFKTPFVPFVPILGVIVCLAMIYGLGWTNWLRLAVWLAIGLIVYFGYS
KKNSVLNNPDKK
NT seq 1479 nt NT seq  +upstreamnt  +downstreamnt
atgtctatttggaaaaaaaaatcaatatctcttttgcttgcagaagcatctgagtctgag
aaaggtttaaaaagaacactaaccgcttggtcgcttgtcgcattaggagttggcgcaatt
ataggagctggtctttttgttagaaccgcaacggcggctgcccaaaacgctgggccatca
gtaacaatcgcatttattatagcagctattggctgtgctttggcagggctttgttatgca
gaattgtcttcatctattccaatttcaggaagcgcatatacttatacttatgcaacaatg
ggagagcttttagcttggataattggttgggatttaatactagagtatgccgtaggggct
gccactgttgggatcgcttggagtgagtatctaaataacttgctggtaaatgtgcttcat
actagtcctataccttattctttatcacattcgccttttcaaatttctgcatcaggagaa
catggtataataaaccttcctgccttctttattgtagcagtaataagtttgttgctaatt
aaaggaacacaagaatctgcatttgtaaatggtatcattgtacttgtaaaagtatctatt
gtaataatgattattgtatttggttggaattttataaacccaataaatcatactccttat
ataccacagccttcaatatttatagatgactcaggtgtgggacataattacggaggaatc
atgggtattttaggagcagcaggaacagtattttttgcttttatcggatttgatgcagtt
agtacagcggcacaagaaactaaaaacccaaaaagagatatgccaattggtattttaggc
tcattagctgtttgtactgttttgtatattctttttgcacacgttttaactggacttgaa
tctgtagaattttttagaacaagcggaaaagaagcatcggttgcaaatgtaattaccact
gcaatggttggttacgagtggttagcccagtttgtaacagtagctattttatttggattt
acctcggtaattttagtaatgttactaggtcaatctagggttttttacgctatgggtaaa
gatggtttattgccaaaagcattcggagacttacattctaaatacaaaacaccatacaaa
gcaaaccttgtcattttagtaattgttggtgcatttgctgcttttgttccgggagatata
gtaggagatatgactagtataggtactttatttgcatttattttagtttgtgtttctgta
attgtattaagaaaaacagatccagatatgaaacgcgaattcaaaactccattcgtacca
tttgtgccaattttaggtgtaatagtttgtttagcaatgatatacggtcttggctggaca
aactggttaagacttgcagtttggctagcaataggacttattgtatatttcgggtatagt
aaaaaaaatagcgttttaaacaatcctgataaaaaataa

DBGET integrated database retrieval system