KEGG   Fusarium pseudograminearum: FPSE_10415Help
Entry
FPSE_10415        CDS       T03456                                 

Definition
(RefSeq) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
fpu  Fusarium pseudograminearum
Pathway
fpu00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:fpu00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    FPSE_10415
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:fpu02000]
    FPSE_10415
Enzymes [BR:fpu01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     FPSE_10415
Transporters [BR:fpu02000]
 Other Transporters
  Pores ion channels [TC:1]
   FPSE_10415
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: GST_N_3 GST_N_2 GST_N GST_C_2 GST_C GST_C_3
Motif
Other DBs
NCBI-GeneID: 20369032
NCBI-ProteinID: XP_009261807
UniProt: K3VXS8
LinkDB All DBs
Position
2
AA seq 280 aa AA seqDB search
MTNVDTSLPPEPTGAAANFAARHSEEHPLKLYGGWFCPFVQRSWITIHEKRIPHQYVEIN
PYKKEPHFLALNPRGLVPTLAVPFDAQGKEQKALFESNIVCEYLDEAFFDESKHGPRLLP
TEPYEKARCRIWIDHISTRIIPAWYKLMQHTPDKSFSLEDAREELRGHIKSFVEEMDPEG
PWFLGTTLSLVDICFAPWAKRLFLIDYYKEGGHGIPTTGEGEDGDVWKRWNRWYEAILER
DSVNETWSADERYIIAYKRYAEDTTNSEVGQATRSGKRLP
NT seq 843 nt NT seq  +upstreamnt  +downstreamnt
atgaccaacgtcgatacttcattgcccccggagcccactggcgctgccgccaactttgct
gctcggcattcagaggagcacccgctgaagctttacggcggctggttctgtccttttgtt
cagcggagttggatcactatccatgagaagagaatccctcatcaatatgtcgagatcaat
ccttacaaaaaagaacctcacttcttggcactgaaccctcgcgggctggtgcccacactt
gcggtcccctttgacgcacaaggcaaagagcagaaagctttgttcgagagcaacattgtc
tgcgagtatctggatgaagcattctttgatgagtcaaagcatggtcctcgtctgcttcct
acggaaccatatgagaaggctcgatgtcgtatctggatcgatcatatcagcacacgcatt
atccctgcctggtacaagctcatgcaacacactcccgacaaatctttcagcctcgaagat
gcaagagaagaactcagaggtcatattaaatccttcgtggaagagatggaccctgaaggt
ccatggtttcttggcacgactctgagtctcgtggatatttgcttcgcgccctgggcaaaa
cgcttatttcttattgattattacaaggaaggtgggcacggtattcctacaactggtgag
ggcgaagacggcgatgtttggaagaggtggaacaggtggtatgaggcgattcttgaacgt
gacagtgtgaacgagacgtggagtgctgatgagcgatacataatcgcttataagagatat
gccgaggatactaccaactccgaggttggtcaggctacacgatcaggcaaacggcttcct
tag

DBGET integrated database retrieval system