KEGG   Frankia sp. EuI1c: FraEuI1c_5102Help
Entry
FraEuI1c_5102     CDS       T01354                                 

Definition
(GenBank) Aldehyde Dehydrogenase
Organism
fri  Frankia sp. EuI1c
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh
Motif
Other DBs
NCBI-ProteinID: ADP83091
UniProt: E3J5K4
LinkDB All DBs
Position
6271165..6272664
Genome map
AA seq 499 aa AA seqDB search
MQVQDRLFIGGGWVAPAGANTIEVVSPHTEEVVGRVPEGTVADLDAAVAAAREAFDKGPW
PRLSPAARADAIGRLTAVLNRRAEEAARVISTEMGSPVSWALFGQVYSATFALDYFAGLA
RTFSFTEVRAGMLGPALVRRLPVGVVGAIVPWNVPLYVTALKLGPALASGSTIVIKPAPE
TPLSAILLAEAVEEAGLPPGVVNIVPAHREVAEHLVRHPGVDKISFTGSTAAGRRIAAIC
GERLARCTLELGGKSAALLLPDVDIEAALPALLPAALMNNGQACVAQTRLLAPRERYDEI
VEAVVAKVAAMKVGDPLDAATEIGPLVAARQRERVEGYIAAGRDAGAKVALGGGRPAELD
RGFYVEPTVFSEVDNGMKIAQEEIFGPVLAVIPYSGVDEAVSIANDSRYGLSGSVWTADT
DRGLEVSARIRTGTFNVNTFMLENAAPFGGFKESGVGRELGPEGLSAYLEYQSVNLPAGW
TPAEPPAPRDGTDAAGARV
NT seq 1500 nt NT seq  +upstreamnt  +downstreamnt
atgcaggtccaggaccggctgttcatcggcggcggctgggtggcccctgccggggcgaac
acgatcgaggtggtctcgccgcacaccgaggaggtggtcggccgggttccggagggcacg
gtcgccgacctcgacgccgccgtcgccgccgcgcgggaggccttcgacaagggcccctgg
ccgcggttgtccccggccgcgcgggccgacgcgatcgggcgtctgacggccgtgctgaac
cggcgcgccgaggaggccgcccgggtgatcagcaccgagatgggcagccccgtgagctgg
gcgctgttcggccaggtctactccgcgacgttcgcgctggactacttcgcgggcctggcc
cggacgttctcgttcaccgaggtgcgcgccggcatgctcggcccggccctggtacggcgg
ctgccggtcggcgtcgtcggcgcgatcgtgccgtggaacgtgccgctctacgtcaccgcg
ctcaagctcgggccggcgctggcgtccggctccaccatcgtgatcaaaccggcgccggag
acgccgctgtccgcgatcctgctcgcggaggcggtcgaggaggccgggctcccgccgggc
gtcgtcaacatcgtgccggcccaccgcgaggtcgccgagcacctggtccgccatcccggc
gtcgacaagatcagcttcaccggctccacggcggccggccggcggatcgccgcgatctgc
ggggagcggctggcccgctgcaccctggagctcggcggcaagtcggccgcgctgctgctc
cccgacgtcgacatcgaggccgcgctgccggcgctgctgccggcggcgctgatgaacaac
ggccaggcctgcgtcgcgcagacccggctgctcgcgccgcgggaacgctacgacgagatc
gtcgaggctgtggtcgccaaggtggccgccatgaaggtcggcgacccgctggacgccgcc
accgagatcggcccgctggtggccgcccggcagcgcgagcgggtcgagggctacatcgcc
gccgggcgggacgcgggcgcgaaggtcgcgttgggcggcggccggccggccgagctggac
cggggcttctacgtcgagccgacggtcttctcggaggtcgacaacggcatgaagatcgcc
caggaggagatcttcgggccggtgctggcggtgatcccctactcgggcgtcgacgaggcc
gtctcgatcgccaacgactcccgctacggcctgtcgggctcggtgtggacggccgacacc
gaccgcgggctcgaggtctccgcccggatccgcaccggcacgttcaacgtcaacacgttc
atgctggagaacgcggcgccgttcggcgggttcaaggagtccggcgtcggccgcgagctg
gggccggagggtctctcggcgtacctggagtaccagtcggtgaacctcccggccggctgg
actcccgccgagccaccagcgcctcgcgacggaacggacgccgccggagcgcgggtgtga

DBGET integrated database retrieval system