KEGG   Frankia inefficax: FraEuI1c_5929Help
Entry
FraEuI1c_5929     CDS       T01354                                 

Definition
(GenBank) methylmalonate-semialdehyde dehydrogenase
  KO
K00140  malonate-semialdehyde dehydrogenase (acetylating) / methylmalonate-semialdehyde dehydrogenase [EC:1.2.1.18 1.2.1.27]
Organism
fri  Frankia inefficax
Pathway
fri00280  Valine, leucine and isoleucine degradation
fri00410  beta-Alanine metabolism
fri00562  Inositol phosphate metabolism
fri00640  Propanoate metabolism
fri01100  Metabolic pathways
fri01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:fri00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    FraEuI1c_5929
   00562 Inositol phosphate metabolism
    FraEuI1c_5929
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    FraEuI1c_5929
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    FraEuI1c_5929
Enzymes [BR:fri01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.18  malonate-semialdehyde dehydrogenase (acetylating)
     FraEuI1c_5929
    1.2.1.27  methylmalonate-semialdehyde dehydrogenase (CoA-acylating)
     FraEuI1c_5929
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh LuxC
Motif
Other DBs
NCBI-ProteinID: ADP83913
UniProt: E3IYG8
LinkDB All DBs
Position
complement(7295325..7296815)
Genome map
AA seq 496 aa AA seqDB search
MREIGHWIDGKAVAGGSGRFGPVWNPATGEQAAQVALASLEEINAAVASAKAAFTGWRST
GLGRRAEVMFRFRELLYANRTELAKLITAEHGKTVDDALGEIARGLENVEFACGAPSLLR
GGFSEQVSTGVDVHEIRQPLGVVAGITPFNFPAMVPLWMLSNALACGNAFILKPSERDPS
ASLLLAELLAQAGVPDGVFTVLQGDKLAVDTLLTHPDVEALSFVGSTPIARYVYETGTAA
GKRVQALGGAKNHMIVLPDADIAAAADAAVSAGYGSAGERCMAVSVVAAVGDSADPLVEA
IAERVRKIKVGPGLDPDSEMGPVITREARDRVAGYLETAKTDGATLVIDGRDDPISSGPG
FFLAPSLIDNVSTTSTVYTDEIFGPVLAVVRCETYTEAVKLVEDNPYGNGVAIYTRDGGA
ARRFTFDVQAGMVGVNVPIPVPVSYYSFGGWKASLFGDLHMYGPDGIRFYTKTKVVTTRW
PDPATSSVELGFPRTR
NT seq 1491 nt NT seq  +upstreamnt  +downstreamnt
atgcgggaaatcgggcactggatcgatggcaaggcggtggcgggcggctccggccggttc
gggccggtgtggaacccggcgaccggtgagcaggccgcgcaggtcgccctggcgagcctc
gaggagatcaacgcggcggtcgcgagcgccaaggcggcgttcaccggctggcgcagcacc
ggcctcggccgccgggccgaggtgatgttccggttccgtgagctgctgtacgccaaccgg
accgagctcgcgaagctcatcaccgccgagcacggcaagaccgtcgacgacgcgctcggc
gagatcgcgcgcggcctggagaacgttgagttcgcctgtggcgcgccgagcctgctgcgc
ggcggcttctccgagcaggtgtcgaccggcgtcgacgtccacgagatccgtcagccgctg
ggcgtcgtcgcgggcatcaccccgttcaacttcccggcgatggtcccgctgtggatgctg
tcgaacgcgctggcctgcggcaacgcgttcatcctcaagccctccgagcgtgacccgtcg
gcgtcgctgctgctcgccgagctgctcgcccaggccggcgtgccggacggtgtgttcacc
gtgctccagggcgacaagctcgccgtcgacacgctgctcacccatccggacgtcgaggcg
ctcagcttcgttggttcgaccccgatcgcccgctacgtctacgagacgggcaccgcggcc
ggcaagcgggtgcaggccctcggcggcgcgaagaaccacatgatcgtgctgccggacgcg
gacatcgcggccgcggccgacgccgctgtctcggctggctacggctccgccggtgagcgc
tgcatggcggtctccgtcgtcgccgcggtcggtgactccgccgacccgctggtcgaggcg
atcgccgagcgcgtccgcaagatcaaggttggcccgggcctcgacccggacagcgagatg
ggcccggtcatcacccgcgaggcccgcgaccgggtcgccggctacctggaaaccgccaag
accgacggcgccaccctcgtcatcgacggccgcgacgacccgatctcgtctggccccggc
ttcttcctcgccccgagcctgatcgacaacgtgtcgacgaccagcacggtctacaccgac
gagatcttcggcccggtcctcgcggtggtccgctgcgagacctacaccgaggcggtgaag
ctcgtcgaggacaacccgtacggaaacggcgtcgcgatctacacccgcgacggcggcgcc
gcgcgccggttcaccttcgacgtccaggccggcatggtcggcgtcaacgtgccgatcccg
gtgccggtgtcgtactacagcttcggcggctggaaggcgtcgctattcggcgacctgcac
atgtacggccccgacggcatccgcttctacaccaagaccaaggtcgtcaccacccgctgg
cccgacccggcgacgagctcggtcgagctgggcttccccaggacgcggtga

DBGET integrated database retrieval system