KEGG   Frondihabitans sp. PAMC 28766: AX769_20525Help
Entry
AX769_20525       CDS       T04281                                 

Definition
(GenBank) 4-aminobutyrate--2-oxoglutarate transaminase
  KO
K07250  4-aminobutyrate aminotransferase / (S)-3-amino-2-methylpropionate transaminase [EC:2.6.1.19 2.6.1.22]
Organism
frp  Frondihabitans sp. PAMC 28766
Pathway
frp00650  Butanoate metabolism
frp01100  Metabolic pathways
frp01120  Microbial metabolism in diverse environments
Module
frp_M00027  GABA (gamma-Aminobutyrate) shunt
Brite
KEGG Orthology (KO) [BR:frp00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00640 Propanoate metabolism
    AX769_20525
   00650 Butanoate metabolism
    AX769_20525
  09105 Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    AX769_20525
   00280 Valine, leucine and isoleucine degradation
    AX769_20525
  09106 Metabolism of other amino acids
   00410 beta-Alanine metabolism
    AX769_20525
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:frp01007]
    AX769_20525
Enzymes [BR:frp01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.19  4-aminobutyrate---2-oxoglutarate transaminase
     AX769_20525
    2.6.1.22  (S)-3-amino-2-methylpropionate transaminase
     AX769_20525
Amino acid related enzymes [BR:frp01007]
 Aminotransferase (transaminase)
  Class III
   AX769_20525
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_3
Motif
Other DBs
NCBI-ProteinID: AMM22094
UniProt: A0A126Z6A8
LinkDB All DBs
Position
4308895..4310247
Genome map
AA seq 450 aa AA seqDB search
MTIVDSGHRTGGPTLPQQRRLVTEIPGPRSRELLARKSSAVAQGIGISLPVFTDVAGGGV
LVDVDGNSFIDLGTGIAVTGVGNAAPAVVEAVQEQVGRFTHTCFMVTGYDLYVDVAEALN
RLTPGDHDKRSALFNTGAEAVENAVKIARSYTGKQAVVAFDHAYHGRTNLTMALTAKSMP
YKSGFGPFAPEIYRAPLSYPYRDGLDGPTAAKLAISMIEKQIGAANLAAILIEPIQGEGG
FIVPAPGFLTALSEWASANDVVFIADEVQTGFARTGAMFACEHEGIVPDLITTAKGIAGG
LPLSAVTGRAEIMDAPHVGGLGGTYGGNPVACAAALAAIDSYEHDGLIERAREIETLMKP
ILTDIQSADPRVGDVRGRGAMIAIEIVDPATGDPDAALTAAIASYSHQHGVVLLTCGTFG
NVIRFLPPLSISDDLLREGLDVVRQALEAS
NT seq 1353 nt NT seq  +upstreamnt  +downstreamnt
atgacgatcgtcgattccggccacaggacgggcgggcccacgctgccacagcagcgccgg
ctcgtcaccgagatccccggcccgcgctcgcgcgagctactcgcccgcaagtcgagcgcc
gtggcgcagggcatcggcatcagcctgcccgtgttcaccgacgtcgccgggggcggtgtg
ctcgtcgacgtcgacggcaacagcttcatcgacctcggcaccggcatcgccgtcacaggc
gtcggcaacgcggccccggcggtcgtcgaggccgtgcaggagcaggtcgggcgcttcacg
cacacctgcttcatggtcaccggctacgacctctacgtcgacgtggcggaggccctcaac
cggctgaccccgggcgaccacgacaagcgctcggccctgttcaacaccggcgccgaggcc
gtcgagaacgccgtcaagatcgcgcgctcgtacacgggcaagcaggccgtcgtcgccttc
gaccacgcgtaccacggccgcacgaacctcacgatggctctgacggcgaagtcgatgccc
tacaagtcgggcttcgggccgttcgcgcccgagatctaccgcgcccccctctcgtacccc
taccgcgacgggctcgacggccctaccgccgcgaaactggccatctcgatgatcgagaag
cagatcggggcggcgaatctcgccgcgatcctgatcgagccgatccagggcgagggcggg
ttcatcgtgcccgcgcccggattcctcaccgccctgtcggagtgggcgagcgccaacgac
gtcgtcttcatcgccgacgaggtgcagaccggcttcgcccgcaccggcgccatgttcgcc
tgcgagcacgagggcatcgtgcccgacctcatcaccaccgccaagggcatcgccggcggc
ctgccgctgtcggccgtcacgggccgggcggagatcatggacgccccccacgtcggcggc
ctcggcggcacctacggcggcaaccccgtggcctgcgccgcagctctcgcggccatcgac
tcgtacgagcacgacggcctcatcgagcgcgctcgtgagatcgagacgctgatgaagccg
atcctgaccgacatccagtcggccgacccccgcgtcggcgacgtccgcgggcgcggcgcg
atgatcgccatcgagatcgtcgaccccgccacgggcgacccggatgccgctctcaccgcc
gccatcgcgtcgtacagccaccagcacggggtggtactcctgacctgcggcaccttcggc
aacgtcatccgtttccttccgccgctctcgatcagcgacgacctgctccgcgaggggctc
gacgtcgtgcgccaggcactggaggcctcatga

DBGET integrated database retrieval system