Fragaria vesca (woodland strawberry): 101311206 Help Entry 101311206         CDS       T02666                                  Name (RefSeq) SKP1-like protein 1B   KO K03094   S-phase kinase-associated protein 1 Organism fve  Fragaria vesca (woodland strawberry) Pathway fve03083   Polycomb repressive complex fve04120   Ubiquitin mediated proteolysis fve04141   Protein processing in endoplasmic reticulum Brite KEGG Orthology (KO) [BR:fve00001]  09120 Genetic Information Processing   09123 Folding, sorting and degradation    04141 Protein processing in endoplasmic reticulum     101311206    04120 Ubiquitin mediated proteolysis     101311206   09126 Chromosome    03083 Polycomb repressive complex     101311206  09180 Brite Hierarchies   09182 Protein families: genetic information processing    04131 Membrane trafficking [BR:fve04131]     101311206    04121 Ubiquitin system [BR:fve04121]     101311206    03036 Chromosome and associated proteins [BR:fve03036]     101311206 Membrane trafficking [BR:fve04131]  Endosome - Lysosome transport   Acidification regulators    RAVE complex     101311206 Ubiquitin system [BR:fve04121]  Ubiquitin ligases (E3)   Multi subunit Ring-finger type E3    SCF complex     Adaptor protein      101311206    Cul7 complex      101311206 Chromosome and associated proteins [BR:fve03036]  Eukaryotic type   Histone modification proteins    Polycomb repressive complex (PRC) and associated proteins     Noncanonical PRC1 (PRC1.1)      101311206   Centromeric chromatin formation proteins    Kinetochore proteins     CBF3 complex      101311206 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  Skp1_POZ Skp1 Motif Other DBs NCBI-GeneID:  101311206 NCBI-ProteinID:  XP_011467750 LinkDB All DBs Position LG6:28959395..28959853 Genome browser AA seq 152 aa AA seqDB search MSTENKKMLTLKSEDGEVFEIEETVAVQSQTIKHMVEDDCADNAIPLPNVKGPILARVIE YLKKHVADAEDNKESKKEDVESLKKFDDEFLKVDQSVLFDLILAANYLNIKELLDLTCQE TPEQIRKTFNIKNDFTPEEEEEVRRENQWAFE NT seq 459 nt NT seq  +upstreamnt  +downstreamnt atgtcgactgagaacaagaagatgttgaccctgaagagtgaggacggagaggtattcgag attgaagagactgttgctgttcagtcacagaccatcaagcacatggtggaggatgactgc gctgacaacgctatccccttgcccaacgtgaaaggccccattcttgccagggtcatcgag tacctaaagaagcacgttgctgatgctgaggacaataaggaaagcaagaaagaagatgtg gagtctctcaagaaattcgacgatgaattcctcaaggtggaccagagcgtgctgtttgac ctgatattggcagccaactatctgaacatcaaggagctgttggacttgacatgtcaggag actcccgaacagattcgcaagactttcaacatcaagaatgacttcacccctgaggaagaa gaggaggttcgaagggagaaccaatgggcttttgagtga

DBGET integrated database retrieval system