KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_0010
Entry
Glaag_0010        CDS       T01483                                 

Definition
(GenBank) DNA-3-methyladenine glycosylase I
  KO
K01246  DNA-3-methyladenine glycosylase I [EC:3.2.2.20]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
gag03410  Base excision repair
Brite
KEGG Orthology (KO) [BR:gag00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    Glaag_0010
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:gag03400]
    Glaag_0010
Enzymes [BR:gag01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.2  Hydrolysing N-glycosyl compounds
    3.2.2.20  DNA-3-methyladenine glycosylase I
     Glaag_0010
DNA repair and recombination proteins [BR:gag03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    DNA glycosylases
     Glaag_0010
SSDB
Motif
Pfam: Adenine_glyco
Other DBs
NCBI-ProteinID: AEE20979
LinkDB
Position
12438..13016
AA seq 192 aa
MHHTRCAWVSQDPIYQDYHDNVWGRPVQNKYELFAKLCLDGQQAGLSWITILKKQDNYYQ
AFHQFDPLRISQMTEQDVERLMQNKGIVRNRLKINSIIKNAKGFLEIEREGTDFSDFIWS
FVDAKPILNSWTDKNQVPTTSSESDAMAKALKKRGFSFVGSTICYAFMQAVGMVNDHTTD
CFCYETTKVKSV
NT seq 579 nt   +upstreamnt  +downstreamnt
atgcaccatactcgttgtgcctgggtttctcaggatccgatatatcaagattatcacgat
aatgtttggggtcgtcctgtgcaaaataagtacgagcttttcgcaaaactgtgtttagac
ggtcagcaagcaggcctaagctggattacgatccttaaaaaacaagataactattatcaa
gcattccatcagtttgacccacttcgtattagtcaaatgaccgaacaagatgtagagcgt
ttgatgcaaaataaaggaattgtaagaaacagattgaagataaattcgattataaaaaat
gcgaaaggttttttagaaattgagcgagaagggactgacttttcggatttcatttggtcg
tttgtcgacgctaaaccgattcttaactcgtggaccgataaaaaccaagtgccaacgaca
tcaagcgaatctgatgcgatggcgaaggcgctgaaaaagcggggcttctcttttgtaggt
agcacaatttgttacgcgtttatgcaagcggtcggtatggtaaatgaccatactactgat
tgtttttgttatgaaacgactaaagttaaaagcgtttag

DBGET integrated database retrieval system