KEGG   Glaciecola sp. 4H-3-7+YE-5: Glaag_3703
Entry
Glaag_3703        CDS       T01483                                 

Definition
(GenBank) single-stranded-DNA-specific exonuclease RecJ
  KO
K07462  single-stranded-DNA-specific exonuclease [EC:3.1.-.-]
Organism
gag  Glaciecola sp. 4H-3-7+YE-5
Pathway
gag03410  Base excision repair
gag03430  Mismatch repair
gag03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:gag00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    Glaag_3703
   03430 Mismatch repair
    Glaag_3703
   03440 Homologous recombination
    Glaag_3703
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:gag03400]
    Glaag_3703
Enzymes [BR:gag01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     Glaag_3703
DNA repair and recombination proteins [BR:gag03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    RecJ
     Glaag_3703
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     Glaag_3703
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      Glaag_3703
SSDB
Motif
Pfam: DHHA1 RecJ_OB DHH 2-ph_phosp
Other DBs
NCBI-ProteinID: AEE24632
LinkDB
Position
complement(4365707..4367425)
AA seq 572 aa
MQIRRRSPVSIEHLPDSINPTLKQIYATRGITSEQQLERSAKALLHYKDMSGVGDAVRIL
ADALAQSKRIIIVGDFDADGATSTALSMLALGMMGCKNHDYLVPNRFNFGYGLSPQIVDV
AHEQGAQVIMTVDNGIACFAGVERAKELGITVLITDHHLAAESLPIADAIVNPNQPNCSF
MSKNLAGVGVAFYLMLALRAHLRGVDWFAQNDIDVPNLADLLDIVALGTVADVVPLDENN
RILVHQGLLRIRSDKCRPGIQALIEVAGRDKRKMVASDLGFVIGPRLNAAGRLDDMSMGI
ECLLTDSDYKAKQIAVELDSLNRERREIEQSMQQEAVTALDSLQLSEQDMPHGLVLYQAD
FHQGVIGILAGRIKEKYFRPTIAFAHQDDEIIKGSARSIPGVHIRDLLEELSTRYPGLII
KFGGHAMAAGLSIEMAKLEEFKKRFTQLAQEHLAGKPLAGELISDGELPAQALTLEFSQL
LKDAGPWGQGFPEPLFDGQFELVEQRIVGHKHLKMMLRMPTGKLVDAIAFNVDTQVWPNE
QCKHVELAYKLDINEFRGRTSLQFLVEGLNPL
NT seq 1719 nt   +upstreamnt  +downstreamnt
gtgcaaatacgccgccgttcccccgtttctattgagcatttacccgactcaatcaatccg
accttaaagcaaatttacgccacccgcggtatcacctctgaacaacagttagagcgaagt
gctaaagcgcttttgcactacaaagacatgtcaggtgtgggcgatgccgtgaggatattg
gccgatgcgttagcgcagagtaaaaggattattattgtaggagacttcgacgccgatggc
gcgacaagtacggcgttaagtatgctcgcactagggatgatgggctgtaaaaaccatgac
tacttggtaccaaatcgctttaactttggttacggccttagcccacaaattgttgatgtt
gcccatgagcaaggtgctcaggtgataatgaccgtagataatggcattgcctgctttgct
ggtgttgagcgagcaaaagagttagggataacagtgctgattacagatcaccatttggcc
gcagaatccttgcccatcgccgatgcgatcgtaaacccaaatcaaccaaactgttcattc
atgtcaaagaatttggcaggggtaggcgtagcgttttatttaatgctcgcactcagagca
cacttgcgcggtgtcgattggttcgcccagaatgatattgatgttccaaatttagctgac
ctgctcgatattgtcgccttagggaccgtagctgacgtggtgcccctagatgaaaacaac
cgtattttagtccatcaaggattactgcgtattcgcagcgataaatgtcgcccaggtatt
caagcgttaattgaagtcgctgggcgcgataaacgtaaaatggtcgcttctgatttaggc
tttgtgattggcccaaggttaaacgccgctgggcggttagacgatatgtctatgggtatt
gagtgcttactaacagactcagattacaaagcaaaacaaattgcggttgaattagacagc
ctaaatcgtgaacgccgcgaaatcgagcaatccatgcagcaagaggcggttactgctctt
gatagtttgcagctgtcagagcaagacatgccccatggcttggttttgtatcaagctgat
ttccatcaaggcgtgataggtatattagctggacgaattaaagaaaagtattttagaccg
acaattgcctttgcccatcaagacgatgagattatcaaaggatcagctcgctcaataccc
ggtgtacatattcgtgatttgttggaagagctcagtacgcgatacccaggccttatcatt
aaatttggtggccatgcgatggcggcgggtttaagcattgaaatggccaagctagaagaa
ttcaaaaagcgttttacccagcttgcacaagagcatttagcgggcaaacccctcgcaggt
gagcttatttcagacggtgagttacccgcacaggcgttaacgttagagttcagccagtta
ctcaaagatgcggggccttgggggcaaggctttccagagcctctttttgatggtcaattc
gaattggtcgaacaacggatcgtaggccacaaacacctaaaaatgatgctgcgcatgccg
accggaaagctagtcgatgctatcgcattcaatgttgatacacaggtgtggccaaatgag
cagtgcaagcatgttgaattagcttacaaactagatataaatgaatttcgtggccgcaca
tcgttgcagtttttggttgagggattaaatccgctgtga

DBGET integrated database retrieval system