KEGG   Granulosicoccus antarcticus: IMCC3135_00785Help
Entry
IMCC3135_00785    CDS       T04938                                 

Gene name
idnD_1
Definition
(GenBank) L-idonate 5-dehydrogenase (NAD(P)(+))
  KO
K00098  L-idonate 5-dehydrogenase [EC:1.1.1.264]
Organism
gai  Granulosicoccus antarcticus
Brite
KEGG Orthology (KO) [BR:gai00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    IMCC3135_00785 (idnD_1)
Enzymes [BR:gai01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.264  L-idonate 5-dehydrogenase
     IMCC3135_00785 (idnD_1)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ThiF Methyltransf_25 Methyltransf_11 PrmA
Motif
Other DBs
NCBI-ProteinID: ASJ70283
UniProt: A0A2Z2NGT5
LinkDB All DBs
Position
complement(174749..175795)
Genome map
AA seq 348 aa AA seqDB search
MQACAIHAAKDLRLIDIQTASTLQEHEVRVRYATGGICGSDIHYYHEGRVGAFAVQEPLI
LGHEIAGTVSEIGSAVTGLKVGQPVAINPNLPCLKCDYCLAGQTNLCQEMVFFGSAAVMP
HIQGGFREELVVPQRQCVGLPDGFDTAIAAFAEPLAICLHAVNRADNLLHKSLLITGCGP
IGCLAIMAARLAGVRHITATDVEDTVLDMALKLGADEVINIRTDAARLEKYESGRGHFDA
AIECSGNPLALRTCLNAVRPRGTIVQTGMMPPGDTPILVNKMLSKELSMKGTFRFHEEFD
LAVDLLVNQRLDVSSLLTGVYAFSDADAAFTAATDRSKHMKIQLRFDA
NT seq 1047 nt NT seq  +upstreamnt  +downstreamnt
atgcaagcttgcgccattcacgccgccaaagaccttcgtctgatcgatattcagacagcc
agcactctccaggaacatgaagttcgtgtccgttatgccaccggtggcatctgcggctcc
gacatccactactatcatgaaggccgtgtgggcgcattcgccgtgcaggaacctctgata
ctgggccatgaaatcgccggtaccgtgagcgaaatcggctccgccgtcaccgggctgaaa
gtgggccaaccagtcgccatcaacccgaacctgccctgcctcaaatgcgactactgcctg
gcaggccagaccaatctgtgccaggaaatggtgttctttggcagcgccgcagtcatgcca
cacatccagggcggctttcgtgaagagctggtggtaccacaacgtcaatgcgtcggtctg
ccagatggattcgacaccgctatcgcagccttcgccgagccgctggctatctgcctgcat
gccgtaaatcgcgcagacaaccttttgcacaaatcattactgattactggctgcggcccg
attggttgcctggccatcatggcggcacgtctggcaggggttcgccacatcaccgccact
gatgtcgaggacacggtgctggacatggccctcaagctgggtgctgatgaagtgatcaac
attcgcacggatgcggctcgattggaaaaatacgaatcaggacgcggtcactttgatgca
gccatcgagtgctcaggcaacccactcgctctgcgaacctgcctgaacgcggtacgtcca
cgcggcaccattgtgcagacgggtatgatgcctcctggtgatacccccatcctggtcaac
aagatgctctccaaggaattgtccatgaaaggcactttccgtttccatgaagagttcgat
ctggcggtggacttactggtcaatcagcgtctggatgtctcttctctgctgacaggcgtc
tacgcattctctgatgccgatgctgcatttacggccgccacagatcgcagcaagcacatg
aagatccaattgcgtttcgacgcttga

DBGET integrated database retrieval system