KEGG   Gallibacterium anatis: UMN179_00998Help
Entry
UMN179_00998      CDS       T01482                                 

Definition
(GenBank) phosphoglyceromutase
  KO
K01834  2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
gan  Gallibacterium anatis
Pathway
gan00010  Glycolysis / Gluconeogenesis
gan00260  Glycine, serine and threonine metabolism
gan00680  Methane metabolism
gan01100  Metabolic pathways
gan01110  Biosynthesis of secondary metabolites
gan01120  Microbial metabolism in diverse environments
gan01130  Biosynthesis of antibiotics
gan01200  Carbon metabolism
gan01230  Biosynthesis of amino acids
Module
gan_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
gan_M00002  Glycolysis, core module involving three-carbon compounds
gan_M00003  Gluconeogenesis, oxaloacetate => fructose-6P
Brite
KEGG Orthology (KO) [BR:gan00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    UMN179_00998
  09102 Energy metabolism
   00680 Methane metabolism
    UMN179_00998
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    UMN179_00998
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:gan04131]
    UMN179_00998
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gan04147]
    UMN179_00998
Enzymes [BR:gan01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     UMN179_00998
Membrane trafficking [BR:gan04131]
 Autophagy
  Chaperone mediated autophagy (CMA)
   Selective cargos
    UMN179_00998
Exosome [BR:gan04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   UMN179_00998
  Exosomal proteins of melanoma cells
   UMN179_00998
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: His_Phos_1
Motif
Other DBs
NCBI-ProteinID: AEC17026
UniProt: F4HFI5
LinkDB All DBs
Position
complement(1075594..1076277)
Genome map
AA seq 227 aa AA seqDB search
MQLVFIRHGLSEWNALNLFTGWRDVNLSEKGVEEAKAAGRKLKEAGFEFDIAFTSVLTRA
IKTCNLVLEESNQLWVPQIKTWRLNERHYGGLQGLNKKEAAQEFGDEQVHIWRRSYDVLP
PELAKDDPNSAHNDRRYKHLPADVVPDCENLKVTLDRVLPFWEDQIAPALLSGKKVLVAA
HGNSLRALAKHIEGISDEGIMDLEIPTGQPLVYELSDDLKVIKKYYL
NT seq 684 nt NT seq  +upstreamnt  +downstreamnt
atgcaattagtgtttattcgtcacggtttaagtgagtggaatgcattgaaccttttcacc
ggttggcgcgatgttaatttaagtgaaaaaggggttgaagaagcaaaagcggcaggacgt
aaattaaaagaagccggttttgaattcgatatcgcatttacttctgtattaactcgtgcg
attaaaacctgtaaccttgttttggaagaatctaaccaattatgggttccgcaaatcaaa
acttggcgtttaaatgaacgtcactacggcggtttacaaggcttaaataaaaaagaagct
gcacaagagtttggtgatgaacaagttcacatttggcgtcgttcttatgatgtattgccg
cctgaattggcaaaagatgatccaaattcagcacataatgatcgccgttataaacatttg
ccggcggatgtcgtgcctgattgcgaaaacttaaaagtgactttggatcgtgtgttacct
ttctgggaagatcaaatcgcgccggcattattatccggtaaaaaagtattggttgcggca
cacggcaactcacttcgcgctttggcgaaacacattgaaggcatttccgatgaaggcatt
atggatttagaaatcccaaccggacagcctttagtgtatgaattaagcgatgatttaaaa
gtcatcaaaaaatattatctttaa

DBGET integrated database retrieval system