KEGG   Gallibacterium anatis: UMN179_01196
Entry
UMN179_01196      CDS       T01482                                 

Definition
(GenBank) F0F1 ATP synthase subunit beta
  KO
K02112  F-type H+/Na+-transporting ATPase subunit beta [EC:7.1.2.2 7.2.2.1]
Organism
gan  Gallibacterium anatis
Pathway
gan00190  Oxidative phosphorylation
gan01100  Metabolic pathways
Module
gan_M00157  F-type ATPase, prokaryotes and chloroplasts
Brite
KEGG Orthology (KO) [BR:gan00001]
 09100 Metabolism
  09102 Energy metabolism
   00190 Oxidative phosphorylation
    UMN179_01196
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   00194 Photosynthesis proteins [BR:gan00194]
    UMN179_01196
Enzymes [BR:gan01000]
 7. Translocases
  7.1  Catalysing the translocation of hydrons
   7.1.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.1.2.2  H+-transporting two-sector ATPase
     UMN179_01196
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.1  Na+-transporting two-sector ATPase
     UMN179_01196
Photosynthesis proteins [BR:gan00194]
 Photosystem and electron transport system
  F-type ATPase [OT]
   UMN179_01196
SSDB
Motif
Pfam: ATP-synt_ab ATP-synt_ab_N T3SS_ATPase_C
Other DBs
NCBI-ProteinID: AEC17219
UniProt: F4H9E3
LinkDB
Position
complement(1297191..1298564)
AA seq 457 aa
MATGKIVQIIGAVIDVEFPQDAVPKVYEALNVETGLVLEVQQQLGGGVVRCIAMGSSDGL
KRGLSVTNTGSPISVPVGTETLGRIMNVLGEPIDERGPIGEKARWSIHRAAPSYEEQANS
TELLETGIKVIDLVCPFAKGGKVGLFGGAGVGKTVNMMELIRNIAIEHSGYSVFAGVGER
TREGNDFYHEMQESNVLDKVSLVYGQMNEPPGNRLRVALTGLTMAEKFRDEGRDVLFFVD
NIYRYTLAGTEVSALLGRMPSAVGYQPTLAEEMGVLQERITSTKTGSITSVQAVYVPADD
LTDPSPATTFAHLDSTVVLSRQIASLGIYPAVDPLDSTSRQLDPQVVGQEHYDVARGVQG
ILQRYKELKDIIAILGMDELSEEDKLVVARARKIERFLSQPFFVAEVFTGSPGKYVPLKE
TIRGFKGILNGEYDHIPEQAFYMVGSIDEVLEKAKKM
NT seq 1374 nt   +upstreamnt  +downstreamnt
atggcaactggaaaaattgtacaaatcatcggtgccgtcattgacgttgagtttccacaa
gatgctgtgccaaaagtgtatgaagcattaaacgttgaaaccggtcttgtgcttgaagtg
caacaacaattaggtggtggtgttgttcgttgtatcgcaatgggatcttcagacggatta
aaacgtggcttgtctgtaactaatacaggcagcccaatttctgtaccggtcggaacagaa
acattaggtcgtattatgaatgtacttggtgagccaattgatgaacgtggtcctatcggc
gaaaaagctcgttggtcaattcaccgtgctgcaccaagttatgaagaacaagcaaacagt
acagaattgttggaaaccggtatcaaagttatcgacttggtttgcccgtttgcgaaaggg
ggtaaagttggtttgttcggtggtgcgggtgtaggtaaaaccgttaatatgatggaactt
atccgtaatattgcgattgaacactcaggttattctgtattcgccggggtaggtgagcgt
actcgtgaaggtaatgacttctaccacgaaatgcaggaatccaacgttttggataaagta
tcacttgtttacggacaaatgaatgagccaccgggtaaccgtttacgtgttgcgttaacc
ggtttgactatggctgaaaaattccgtgatgaaggtcgtgatgtgttgttcttcgtcgat
aatatttatcgttatacccttgcaggtacagaggtatcagcattgttaggacgtatgccg
tcagcggtaggttatcaacctactcttgcggaagaaatgggggttttacaagaacgtatt
acttcaactaaaaccggatcaatcacttccgtacaagcggtttacgttccggcggatgac
ttgactgacccatctccggcaacaacctttgctcacttggattcaaccgttgtattaagc
cgtcaaatcgcttcactcggtatttatcctgcggtagatccgcttgattcaacttcacgt
caattagatccgcaagttgttggacaggaacattatgatgttgcccgtggcgtacagggt
atcttacagcgttataaagaattgaaagatattatcgcaattcttggtatggacgaattg
tctgaagaagataaattagtggtggctcgtgcacgtaaaattgaacgtttcttatcacag
ccgttcttcgttgctgaagtatttactggttcaccgggtaaatatgtgccattaaaagaa
acaattcgcggctttaaaggtattttaaacggagaatatgaccatattcctgaacaagcg
ttctatatggttggttctatcgatgaagtattagaaaaagcgaaaaaaatgtaa

DBGET integrated database retrieval system