KEGG   Gilliamella apicola: GAPWK_0183
Entry
GAPWK_0183        CDS       T03066                                 

Definition
(GenBank) Galactitol-1-phosphate 5-dehydrogenase
  KO
K00094  galactitol-1-phosphate 5-dehydrogenase [EC:1.1.1.251]
Organism
gap  Gilliamella apicola
Pathway
gap00052  Galactose metabolism
gap01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gap00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    GAPWK_0183
Enzymes [BR:gap01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.251  galactitol-1-phosphate 5-dehydrogenase
     GAPWK_0183
SSDB
Motif
Pfam: ADH_N ADH_zinc_N AlaDh_PNT_C Glu_dehyd_C TrkA_N MTS 2-Hacid_dh_C UDPG_MGDP_dh_N DAO Pyr_redox_2 PALP 3HCDH_N
Other DBs
NCBI-ProteinID: AHN24760
LinkDB
Position
181012..182055
AA seq 347 aa
MKAVIVNEGGSLSLEDIDIPKITSPDQILVKIAYCGLCGSDIPRIFHHGAHFYPITLGHE
FSGTVIETGNDVTEFDVGDLISCVPLLPCFKCDECQKHYYSLCKNYTFVGSRIAGGFAEY
IVLHKKNAFKLPKGVSPLEGAFFEPMTVGMHALLLAGGCQNKHVVIVGGGTIGLLAMLCA
KAMGASSIAVLDINDERLNLAKQLGADVIYNSKNLSSDEIYQALSSNRFDQIVLETAGSP
ITVRLAIEIAGPRSKVCLVGTLHNDFTLPEKTFGLILRKELQILGSWMNYSAPWPGEEWL
LVSQFFVEGKINLNDLIAVIGDFNTFIHKVRDLNGQSMNGKILLNCS
NT seq 1044 nt   +upstreamnt  +downstreamnt
atgaaagcggttattgtcaatgaagggggatctctatctttagaagatattgacataccc
aaaattacatctccagatcaaattttagtaaaaattgcttattgtggattatgtggatca
gatattcctagaatatttcatcatggagcacatttttatcctattacgctcggacatgaa
tttagtggtactgttattgaaacaggcaatgatgtgactgagtttgacgttggtgattta
atttcttgtgtaccattattaccatgttttaaatgtgatgaatgtcaaaagcattactat
tcactttgtaaaaattatacttttgtgggatcgagaatagcaggtggttttgctgaatat
attgtattacataaaaaaaatgcatttaaattaccaaaaggagtaagtcctcttgaaggc
gctttttttgagccgatgacagttggaatgcatgctctattattagcaggaggctgccaa
aataaacatgtcgtgattgtaggcggtggaacaatcggactgcttgctatgctttgtgct
aaggcaatgggagcgagttctattgctgttttagatataaatgatgaacgactaaatctt
gccaaacaactaggagcagatgttatttataactctaaaaatcttagttctgatgagatt
tatcaagctttatcttccaatcgttttgatcaaatcgtattagaaacagccggttcgcca
attacagttagattagccattgaaattgcaggtcctagatctaaagtgtgcttggttggt
actctccataatgattttaccttaccagaaaaaacattcggtcttattttacgaaaagag
ttacaaattttaggaagttggatgaactattctgctccatggccaggcgaagaatggcta
ttagtaagtcagttttttgtagaaggtaaaataaatcttaatgatttaatcgctgttatt
ggtgactttaacacatttattcataaagttagagatttaaatggacaatcaatgaatggc
aagattttattaaactgtagttaa

DBGET integrated database retrieval system