KEGG   Gordonia alkanivorans: C5O27_12475
Entry
C5O27_12475       CDS       T05876                                 

Gene name
murG
Definition
(GenBank) undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase
  KO
K02563  UDP-N-acetylglucosamine--N-acetylmuramyl-(pentapeptide) pyrophosphoryl-undecaprenol N-acetylglucosamine transferase [EC:2.4.1.227]
Organism
gav  Gordonia alkanivorans
Pathway
gav00550  Peptidoglycan biosynthesis
gav01100  Metabolic pathways
gav01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gav00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    C5O27_12475 (murG)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    C5O27_12475 (murG)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gav01011]
    C5O27_12475 (murG)
Enzymes [BR:gav01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.227  undecaprenyldiphospho-muramoylpentapeptide beta-N-acetylglucosaminyltransferase
     C5O27_12475 (murG)
Peptidoglycan biosynthesis and degradation proteins [BR:gav01011]
 Precursor biosynthesis
  Glycosyltransferase
   C5O27_12475 (murG)
SSDB
Motif
Pfam: Glyco_tran_28_C Glyco_transf_28 Glyco_transf_4 DUF3188
Other DBs
NCBI-ProteinID: AZZ81787
UniProt: A0A3T0V035
LinkDB
Position
2748415..2749623
AA seq 402 aa
MSSGAAQSDTTGGPGGRPLSVVVAGGGTAGHIEPALAVADAITRIDPTARVTALGTSRGL
EVDLVPERGYDLRLIPPVPLPRKPGMDLAKTPGRLVSSVAATRKVLADVDADVVIGFGGY
VSVPAYLAAQMHLRGRNRIPIVIHEANASAGIANKVGARFADRILAAVDGSGLDATVVGM
PVRGVLTELDRPALRAKARHYFGLDEDAPTLLVFGGSQGAQRINAAVSGAAEALAKAGIG
VLHAYGPKNSIDPVIVEGAPPYRGVGYLKRMDLAYAAADLVMCRSGAMTVAEVSATGLPA
VYVPLPHGNGEQRLNALPVVEAGGGLIVEDSAVSAEWVAREVPALLQDAERLQKMSAAAA
GTGHRDAAAAVADAALELARGFRAGRGPVRKAFRSRRSAGEQ
NT seq 1209 nt   +upstreamnt  +downstreamnt
gtgagttcgggtgcagcacaatctgatacgaccggaggcccgggcgggcggccgttgtcg
gtggtggtcgcgggcggtggtaccgccggacacatcgaacccgcgctcgccgtggccgac
gcgatcacccgcatcgacccgacggcccgcgtcaccgcactcgggaccagccgcggcctg
gaggtcgacctggtgcccgaacgcggatacgaccttcggctgatcccgccggtcccgttg
ccgcggaaacccgggatggacctcgccaagactcccggccgcctggtgtcctcggtcgcc
gcgacccgcaaggtgctcgccgacgtggatgccgacgtcgtcatcggcttcggcgggtac
gtgtccgtgccggcctacctcgccgcgcagatgcacctgcgcggacgcaaccgcatcccg
atcgtcatccacgaggcgaatgcctcggcgggcatcgccaacaaggtgggcgcccgcttc
gccgaccgaatcctggccgccgtcgacggttccggcctcgacgcgaccgtcgtcggcatg
ccggtccgcggtgtcctcaccgagctggaccggcctgctctgcgggccaaggcgcgacac
tacttcggtctcgacgaggacgccccgaccctgctcgtcttcggtggatcccaaggcgcg
caacgcatcaacgccgcggtttcgggtgcggccgaagccctcgcaaaggcgggcatcggt
gtcctgcacgcctacgggcccaagaactcgatcgatccggtgatcgtcgagggcgccccg
ccgtaccgcggcgtcggctacctcaagcggatggatctcgcctacgccgcggccgacctg
gtgatgtgccggtccggtgcgatgaccgtcgccgaggtgtcggccaccggtctgcccgcc
gtctacgtcccgctgccacacggcaacggcgaacaacgcctcaacgcgctaccggtcgtc
gaggccggtggcggactcatcgtcgaggactcggcggtcagcgcggagtgggtggcacgc
gaggtgccggccctcctgcaggacgcggagcgactgcagaagatgtccgcggcggccgcg
ggcacgggccatcgtgacgccgcggcggccgtcgccgacgccgctctcgaactcgctcgc
ggattccgcgcgggccggggcccggtccgcaaggcgtttcgttcccgccgatcggccggc
gagcagtga

DBGET integrated database retrieval system