Granulibacter bethesdensis CGDNIH2: GbCGDNIH2_0475 Help Entry GbCGDNIH2_0475    CDS       T03083                                  Name (GenBank) Cell division inhibitor MinE   KO K03608   cell division topological specificity factor Organism gbh  Granulibacter bethesdensis CGDNIH2 Brite KEGG Orthology (KO) [BR:gbh00001]  09180 Brite Hierarchies   09182 Protein families: genetic information processing    03036 Chromosome and associated proteins [BR:gbh03036]     GbCGDNIH2_0475   09183 Protein families: signaling and cellular processes    04812 Cytoskeleton proteins [BR:gbh04812]     GbCGDNIH2_0475 Chromosome and associated proteins [BR:gbh03036]  Prokaryotic type   Chromosome partitioning proteins    Inhibitors of FtsZ assembly     GbCGDNIH2_0475 Cytoskeleton proteins [BR:gbh04812]  Prokaryotic cytoskeleton proteins   MinD / ParA class of bacterial cytoskeletal proteins    GbCGDNIH2_0475 BRITE hierarchy SSDB OrthologParalogGene clusterGFIT Motif Pfam:  MinE DUF493 Motif Other DBs NCBI-ProteinID:  AHJ67494 LinkDB All DBs Position 538622..538876 Genome browser AA seq 84 aa AA seqDB search MSLFGFLQRKPTAQVARNRLQILLAHERGLEGNADLAAILQEEIIAVIAKHVEIDREKVQ VKLDRGSAFSTLEIDVEMPNGKKA NT seq 255 nt NT seq  +upstreamnt  +downstreamnt gtgagcttattcggctttctccaacgtaaaccgacggcccaggtcgcccgcaaccggctt cagattctgctggcgcatgagcgggggctggagggtaatgctgaccttgccgccatcctg caggaagagattattgcggtcatcgcgaagcatgtcgagatcgaccgggaaaaggtgcag gtcaagcttgatcgcggctctgctttttccacactggaaatcgatgtcgagatgccaaat ggaaagaaggcttga

DBGET integrated database retrieval system