KEGG   Geobacillus sp. JS12: A0V43_10740Help
Entry
A0V43_10740       CDS       T04412                                 

Definition
(GenBank) alkyl hydroperoxide reductase subunit F
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
gej  Geobacillus sp. JS12
Brite
KEGG Orthology (KO) [BR:gej00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    A0V43_10740
Enzymes [BR:gej01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     A0V43_10740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 HI0933_like FAD_binding_2 DAO FAD_oxidored AlaDh_PNT_C NAD_binding_7 FAD_binding_3 Thi4 Thioredoxin_4 NAD_binding_8 Glutaredoxin FMO-like K_oxygenase
Motif
Other DBs
NCBI-ProteinID: AMQ21287
UniProt: A0A142D2N5
LinkDB All DBs
Position
complement(2190288..2191817)
Genome map
AA seq 509 aa AA seqDB search
MLLDADIKAQLAQYLQLLENDIVLTVSAGDDNVSRDMLALIDELTAMSPKIKVEKAKLER
TPSFSVNRVGENTGITFAGVPLGHEFTSLVLALLQVSGRPPKVSQDVVDRIQQIRGKHHF
ETYVSLTCHNCPDVVQALNIMSVLNPNISHTMIDGAAFKEEAEQKGIMAVPTVFLNSKLF
ASGRMSLEDILAKLGSAPDASSFADKEPFDVLVIGGGPAGATAAIYAARKGIRTGIVAER
FGGQILDTLGIENFISVKYTEGPKLAASIEEHVKQYNVDIMSSQRAKRLEKKDLIEVELE
NGAVLKSKTVVIATGARWRNLGVPGEEEFKNKGVAYCPHCDGPLFEGKHVAVIGGGNSGV
EAAIDLAGIASHVTLLEFAPELKADAVLQDRLYSLPNVTVIKNAQTTEITGTDKVNGLTY
IDRETGEEHHIELQGVFVQIGLVPNTEWLEGTVERNRFGEIIVDKRGATNIEGVFAAGDC
TDSAYKQIIISMGSGATAALSAFDYLIRH
NT seq 1530 nt NT seq  +upstreamnt  +downstreamnt
atgctgttggatgctgacatcaaggcgcaactagctcagtatttgcaattgcttgaaaat
gatattgtcttgacggtaagcgcgggagacgacaacgtttcccgcgatatgcttgcttta
atcgatgaattaacggcgatgtcgccgaaaatcaaagtggaaaaagcgaagctggaacga
acgccaagcttcagcgtcaatcgggtcggcgaaaacaccggcatcaccttcgccggcgtg
ccgctcggccatgaatttacgtccctcgttttggcgctgcttcaagtgagcgggcggccg
ccgaaagtcagccaagacgtcgtggaccgcattcaacaaatcaggggcaaacatcatttt
gaaacgtacgtcagcttgacttgccacaactgcccggacgtcgtgcaagcgctcaacatc
atgagcgtgttaaacccgaacatttcgcatacgatgatcgacggggcggcgtttaaagaa
gaagcggagcaaaaagggattatggccgtaccgacggtgtttttaaacagcaaactgttc
gcgagcggccgcatgtcgcttgaagatatcctcgccaaattagggagtgctccggacgct
tcttccttcgccgacaaagagccgtttgatgtgctggtgatcggcggcggccctgcaggt
gcgacagcagccatttacgcagcgcgcaaaggcattcgcactggcattgtcgcggagcgc
ttcggcggacaaattttagatacgctcggcattgaaaactttatcagcgtcaaatatacg
gaaggaccgaagcttgcggccagcattgaagaacatgtaaagcaatacaacgtcgacatc
atgagctcgcagcgggcaaaacggctcgagaaaaaagacttgattgaagtcgagctggaa
aacggcgctgtgttgaaaagcaaaaccgttgtcatcgcaacgggcgcccgttggcgcaac
cttggcgtgccgggcgaggaagagttcaaaaacaaaggggtcgcctattgcccgcactgc
gacggcccgctgttcgaagggaagcacgtggcggtcatcggcggcgggaactctggagtc
gaagcggcgattgacctcgctggcatcgccagccatgtgacgctgctggagttcgcccct
gaactcaaggcggatgctgttttgcaagatcgtttgtacagcttgccgaacgtaacggtg
attaaaaacgcgcaaacgacggaaatcaccggcacggacaaagtcaacggcttgacgtac
attgaccgggaaacaggagaagaacatcatatcgaattgcagggcgtgttcgtgcaaatc
ggccttgttccgaacaccgaatggttggaaggaacggtggaacggaatcgcttcggtgaa
atcattgttgataaacgcggcgcaacgaacattgaaggcgtctttgccgcaggcgactgc
acggacagcgcctataagcaaattattatctcgatgggctcgggtgcaaccgcggcgtta
agcgcgtttgattatttgattcgccattaa

DBGET integrated database retrieval system