KEGG   Geospiza fortis (medium ground-finch): 102035566Help
Entry
102035566         CDS       T03755                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin-endoperoxide synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr00590  Arachidonic acid metabolism
gfr01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    102035566 (PTGS1)
Enzymes [BR:gfr01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     102035566 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF EGF_2 hEGF
Motif
Other DBs
NCBI-GeneID: 102035566
NCBI-ProteinID: XP_005421301
LinkDB All DBs
Position
Un
AA seq 586 aa AA seqDB search
MQRCAGWMVMSLSLSLPAVNPCCYFPCQNQGVCVRVGLRGYECDCTRTGYYGLNCTSPEF
WTRLHNLLKPSPAFYHFILTHFKWVWDIINSTFIRDTLMRLVLTVRANLIPSPPTFNSDY
GYISWEAYANVSYYTRVLPPVPDDCPTPMGTKGKLQLPDPQLLAERFLLRHKFEADPRGT
NMMFAFFAQHFTHQFFKTSGKMGRGFTKALGHGVDLGHLYGDNLQRQHQLRLFRDGKLKF
QVVDGEVYPPTVSEAPVHMVYPSGVPQEQQLAVGQEVFGLLPGLCVYATLWLREHNRVCD
LLKREHPTWSDEQLFQTARLILIGETIKIVVEDYVQHLSGYYLSLKFDPELLFGSQFQYR
NRIAVEFNQLYHWHGLMPDSFIIQGQEYSYKQFLYNTSMLMDYGVEALVESFSKQVAGRI
GGGQTINANVLHVAVGVIKESRQLRLQPFNEYRKRFGMKPYKSFQELTGEEEKAAELEEL
YGDIDALEFYPGLLLEKPQPNGIFGESMVEIGAPFSLKGLFGNPICSPEYWKPSTFGGAT
GFEIVKTASLEKLVCLNVKKCPYVAFHVPDTAEHGSPRAAGSSTEL
NT seq 1761 nt NT seq  +upstreamnt  +downstreamnt
atgcagagatgtgctggctggatggtgatgtctctctctctctctctccctgcagtgaat
ccctgttgctatttcccctgccagaaccaaggggtgtgtgtgagggtcggcctgagagga
tacgagtgtgactgcacccggaccggctactacgggctcaactgcacctcccctgagttc
tggacacgtctccacaacttgctgaagcccagtcctgctttctaccacttcatcctgacc
cacttcaagtgggtttgggacattatcaacagcaccttcatcagggacacgctcatgagg
ctcgtgctgacagttcgtgccaatctcatccccagcccccccactttcaactctgactat
ggttacatcagctgggaggcctatgccaacgtcagctactacacccgcgtcctgccgccc
gtgccggacgactgccccacgcccatgggcaccaaagggaagctgcagctccctgacccc
cagctcctggcagagaggttcctgctgcggcacaagtttgaggctgatccccgaggcacc
aacatgatgtttgccttcttcgcccagcatttcacccaccagttcttcaagacatctggg
aagatgggacgtggcttcaccaaggctctgggacatggggtggacctgggacatttgtac
ggggacaaccttcagcggcagcaccagctgcgactcttccgagatgggaagctgaaattc
caggtggtggatggcgaggtgtacccgcccacggtcagcgaggccccggtgcacatggtg
tacccgtcgggcgtgccccaggagcagcagctggccgtggggcaggaggtgttcgggctg
ctgccggggctctgcgtctacgccacgctctggctgcgcgagcacaaccgcgtctgcgac
ctgctcaagcgggagcaccccacctggagcgacgagcagctcttccagacagcgcggctc
atcctcatcggggagaccattaagatcgttgttgaggactacgtgcagcacctcagtggg
tactacctgagcctcaagttcgaccccgagctgttgtttgggtcccagttccagtaccgg
aaccgcatcgccgtggagttcaaccagctctatcactggcacgggctgatgcccgactcc
ttcatcatccagggacaagagtacagctacaagcagttcctctacaacacctccatgctc
atggactatggcgtggaggcgctggtggagtccttttccaagcaggtagcaggaaggatc
ggtgggggacagaccatcaatgccaatgtcctgcacgtggccgttggggtcatcaaggag
tcccggcagctgaggctgcagcccttcaacgagtaccggaaaaggtttggcatgaagccc
tacaagtccttccaggagctgacaggagaggaagagaaggcagcagagctggaagagctg
tatggagacattgatgctctggagttttacccaggcttgctgctggagaaaccccaaccc
aatggcatttttggggaaagcatggtggagatcggagctccattttccctgaaggggctt
tttggaaatcccatctgctccccagagtactggaaacccagtacatttggtggagcaact
ggctttgagatcgtgaagacggcatccctggagaagcttgtgtgcctcaacgtgaagaag
tgcccgtacgtggcgttccacgtgcctgacaccgcggagcacggcagccccagggctgct
ggatcctctacagagctctag

DBGET integrated database retrieval system