KEGG   Geospiza fortis (medium ground-finch): 102038349
Entry
102038349         CDS       T03755                                 

Gene name
SFN
Definition
(RefSeq) stratifin
  KO
K06644  stratifin
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04110  Cell cycle
gfr04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    102038349 (SFN)
   04115 p53 signaling pathway
    102038349 (SFN)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gfr04147]
    102038349 (SFN)
Exosome [BR:gfr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   102038349 (SFN)
  Exosomal proteins of colorectal cancer cells
   102038349 (SFN)
  Exosomal proteins of bladder cancer cells
   102038349 (SFN)
SSDB
Motif
Pfam: 14-3-3 Peptidase_C98 FliM
Other DBs
NCBI-GeneID: 102038349
NCBI-ProteinID: XP_005427141
UniProt: A0A6I9HP38
LinkDB
Position
Un
AA seq 246 aa
MARNQQVQKAKLAEQAERYEDMADFMKAVVEHGDELSNEERNLLSVAYKNVVGCQRSAWR
VISSIEHKTEEGDDKAQVVNEYREKVEQELNAVCNNVLGLLDKYLIKKDSDTESKVFYLK
MKGDYFRYLAEVASGDDRLSTIEKAQEAYQEAMDISKKEMQPTNPIRLGLALNFSVFHYE
IANAPEQAISLAKTTFDEAMGDLHTLSEDSYKDSTLIMQLLRDNLTLWTAECAGEDGGEA
GEEPKN
NT seq 741 nt   +upstreamnt  +downstreamnt
atggcaagaaaccagcaggtgcagaaggccaagctggccgagcaggctgagcgctacgag
gacatggcagacttcatgaaggccgtggtggagcacggggacgagctgtccaacgaggag
cgcaacctgctctccgtggcctacaagaacgtggtgggctgccagcgctcggcctggagg
gtcatctccagcatcgagcacaaaaccgaggagggcgacgacaaggcgcaggtggtgaac
gagtaccgggagaaggtggagcaggagctgaacgccgtctgcaacaacgtgctgggcttg
ctggacaagtatctcatcaagaaggacagcgacaccgagagcaaggtcttctacctgaag
atgaagggcgactatttccgatacctggccgaggtggccagcggggacgaccgcctgtcg
acgatagagaaggcccaggaggcctaccaagaggccatggacatcagcaaaaaggagatg
cagcccacgaaccccatccgcctggggctggccctcaacttctccgtgttccactacgag
atcgccaacgcccccgagcaggccatctccctggccaagaccaccttcgacgaggccatg
ggcgacctgcacacgctcagcgaagactcctacaaggacagcaccctcatcatgcagctg
ctcagggacaacctcacgctatggacagccgagtgtgctggcgaagacggcggcgaggct
ggcgaagagcccaagaactga

DBGET integrated database retrieval system