KEGG   Geospiza fortis (medium ground-finch): 102040029
Entry
102040029         CDS       T03755                                 

Gene name
CD82
Definition
(RefSeq) CD82 molecule
  KO
K06509  CD82 antigen
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102040029 (CD82)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:gfr04147]
    102040029 (CD82)
   04090 CD molecules [BR:gfr04090]
    102040029 (CD82)
Exosome [BR:gfr04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   102040029 (CD82)
  Exosomal proteins of other body fluids (saliva and urine)
   102040029 (CD82)
  Exosomal proteins of colorectal cancer cells
   102040029 (CD82)
CD molecules [BR:gfr04090]
 Proteins
  102040029 (CD82)
SSDB
Motif
Pfam: Tetraspanin DUF2981
Other DBs
NCBI-GeneID: 102040029
NCBI-ProteinID: XP_005419535
LinkDB
Position
Un
AA seq 265 aa
MGSGCLKVTKYFLFLFNLLFLILGAVILGFGVWILADKTSFIAVLQMSSPSLKTGAYILI
GVGALTMLMGFLGCLGAVNEIRCLLGLYFTCLMLILLAQIAAALVIYFQKETLKVELSGI
VVDLIENYDPSDEDKRNLQDAWDYVQTQIACCGWTGAKEWENNEILRNKSNTEYPCSCSN
RSKDLVEGRGFCNLEDPLNGTATYADWPVHEQGCMDGVEEWLKDNLGIILGVCTGVAVIE
LLGMILSISLCKNIHSEDYTKVPKS
NT seq 798 nt   +upstreamnt  +downstreamnt
atggggtctggctgcctaaaagtcaccaagtacttcctcttccttttcaacctcctgttc
cttattctgggcgctgtaatcctggggtttggagtatggattctggccgacaaaacgagt
ttcattgcagttctacagatgtcatctccctccctgaagactggtgcatacatcctcatt
ggtgttggggcacttaccatgctgatggggttcctgggctgtcttggagccgtcaatgaa
atccggtgtctcttgggtctgtacttcacctgcctgatgttaatcctcttagctcagatt
gctgctgcactggtcatctacttccagaaagaaacgctgaaagttgagttgtctggcata
gttgtagatctgattgaaaattatgacccttcggatgaagataagaggaacttgcaagat
gcatgggactatgtgcagacacagattgcctgctgtggctggactggagcaaaggaatgg
gaaaataatgagattcttaggaacaaaagcaatactgagtatccgtgctcctgctccaat
agatctaaggacttagtggaaggaagaggtttctgcaatctggaagaccctctcaatggc
actgcaacatatgctgactggcctgttcatgagcagggatgcatggatggtgtagaggag
tggctgaaggacaaccttggtatcattcttggggtttgcactggtgttgctgttatagag
ctgctggggatgatactgtccatttcactttgcaagaacatacacagcgaagactacacc
aaagtgcccaagtcttga

DBGET integrated database retrieval system