KEGG   Geospiza fortis (medium ground-finch): 102040891
Entry
102040891         CDS       T03755                                 

Gene name
SHISA5
Definition
(RefSeq) shisa family member 5
  KO
K10135  scotin
Organism
gfr  Geospiza fortis (medium ground-finch)
Pathway
gfr04115  p53 signaling pathway
Brite
KEGG Orthology (KO) [BR:gfr00001]
 09140 Cellular Processes
  09143 Cell growth and death
   04115 p53 signaling pathway
    102040891 (SHISA5)
SSDB
Motif
Pfam: Shisa Comm
Other DBs
NCBI-GeneID: 102040891
NCBI-ProteinID: XP_005422536
LinkDB
Position
Un
AA seq 213 aa
MFLREDCQAYSGYFGEVQLAQSCPDFCCGSCLDXYCCSNISLKFDEQKFQCNQLNERNNE
LDKLSVMFDDPDLDFGPSFGTIIAIGITVFAVIVITIILCLTCSCCCLYKACRRPRPVVT
TATTTVVHSAYPQQPAVPPSYAAAPYQGYQPVAVQPQPGMPVAPYPAQYPPPYPTQPAGP
PAYHETVAAGAGAPYPTQPPYNPAYMDPQKPTY
NT seq 642 nt   +upstreamnt  +downstreamnt
atgtttctgcgtgaggattgtcaggcatatagtggttattttggtgaggtacaacttgca
caatcgtgtcctgatttctgctgtggatcttgtctggattgatactgctgctctaatata
tccctaaaatttgatgaacaaaaattccagtgcaatcagcttaatgaaaggaacaatgag
ctggataaactatcagtcatgtttgacgatcctgatttagactttggccccagttttgga
accattattgccattggaattactgtttttgcagtgattgtcatcactattattctgtgc
ctcacctgctcctgttgctgtctgtacaaagcatgtcgaagaccacgccctgtggtgacc
actgccaccacgacagtggttcactctgcctatccccagcagccagcagtgccacccagc
tacgcagcagctccgtaccaaggctaccagcccgtggctgtgcagccccagccgggcatg
cctgtggctccctaccctgcccagtaccctcccccttaccccacccagcctgcaggaccc
ccagcttaccatgaaactgtggcagctggtgctggagccccttaccctacccagccccct
tacaaccctgcttacatggatcctcagaagcccacgtattga

DBGET integrated database retrieval system