KEGG   Gallus gallus (chicken): 420078Help
Entry
420078            CDS       T01006                                 

Gene name
DOT1L
Definition
(RefSeq) histone-lysine N-methyltransferase, H3 lysine-79 specific isoform X1
  KO
K11427  histone-lysine N-methyltransferase, H3 lysine-79 specific [EC:2.1.1.43]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00310  Lysine degradation
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00310 Lysine degradation
    420078 (DOT1L)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:gga03036]
    420078 (DOT1L)
Enzymes [BR:gga01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.43  histone-lysine N-methyltransferase
     420078 (DOT1L)
Chromosome and associated proteins [BR:gga03036]
 Eukaryotic Type
  Histone modification proteins
   HMTs (histone methyltransferases)
    HKMTs (histone lysine methyltransferases)
     420078 (DOT1L)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DOT1
Motif
Other DBs
NCBI-GeneID: 420078
NCBI-ProteinID: XP_015155350
CGNC: 549
Ensembl: ENSGALG00000000843
UniProt: A0A1D5PNL0
LinkDB All DBs
Position
28
AA seq 1734 aa AA seqDB search
MGERLELRLKSPVGAEPAVYPWPLPVYDKHHDAAHEIIETIRWVCEEIPDLKLAMENYVL
IDYDTKSFESMQRLCDKYNRAIDSIHQLWKGTTQPMKLNTRPSNGLLRHILQQVYNHSVT
DPEKLNNYEPFSPEVYGETSFDLVAQMIDEIKMTEDDLFVDLGSGVGQVVLQVAAATNCK
HHYGVEKADIPAKYAETMDREFRKWMKWYGKKHAEYTLERGDFLSEEWRERIANTSVIFV
NNFAFGPEVDHQLKERFANMKEGGRIVSSKPFAPLNFRINSRNLSDIGTIMRVVELSPLK
GSVSWTGKPVSYYLHTIDRTILENYFSSLKNPKLREEQEAARRRQQRENKSNTTTPTKVQ
ENKDSGAEEEKAGANAVKKPSPSKARKKKLSKKGRKMAGRKRGRPKKMNTANTERKTKKN
QTALELLHAQTVSQTSSSSPQDAYKSPHSPYYQLPPKVQRHSSNQLLVTPTPPALQKLLD
SFKIQYMQFMAYMKTPQYKASLQQLLEQEKEKNAQLLGTAQQLFTHCQAQKEEIKRLFQQ
KLDELGVKALTYNDLIQAQKEISAHNQQLKEQTKQLEKDNSELRNQSLQLLKARCEELKL
DWSTLSLENLLKEKQALKNQISEKQKHCLELQISIVELEKSQRQQELMQLKSYTPSDESL
SVQLRNKTHLSRDAEADHGRFQLELECSKFPMPHVNGLSPELSMNGHATPYEIHNTFSRP
SSKQNTPQYMTSHLDQEIVPCTPNHSRQKADRMASLSLPDYTRFSPAKIALRRHLNQDHT
VNGKATTSEIQRADHVKENGLTYPSPSISNGIKLSPQETRPSSPAALPIAGEKVLRERTS
VSNGETITSLPISIPLSTVQPNKLPVSIPLASVVLPSRVEKVRSTPSPVHQSRDSSTLEK
QIGASSHNGVSNAAGNKPLALATSGFSYSSGSVAVNGNLTNSPAHLNHSVDQAALDDSGS
LFNSVGSRSSTPQHPLLMMQSRNSGQSSPAHQHSASPRLNGTSQSLVGGLHYADAQKMFA
EGTKGDLQSDAAFSDPENEAKRRIIFTISPNTGHVKQSPSTKHSPLPASARLDCGPAHGQ
DGKKRGRRKRSSTGNLSGGSGVSPKRKSLPAVSGLFTQPSGSPLNINSMVNNINQPLEIT
AISSPENSLKNSPVPYQDNDQPPVLKKEKPLTQSNGVHYSPLTSDDEQGSEDEHNSTRIE
RKIATISLESKSPQKTVENGGSLSGRKQAQPNENMNSSKWKSTFSPISDINLTKTTDSPL
QSVSSLSQNSLFAFRPSSEDSLAMDAKMAHARKGMAMPSSGADGLSPSTNPTNGFAYNGG
LSTDIGLHSFIDGASLPHKASDGTAAACSLGFQSQRSKDVGISETNPFLNKRQLEGLGGA
KGEDLSRAGVKSKDMSEMSIRAGGSSEKNSLQHNGKVGKGRDRDVEFKNGHNLFISAAVS
SGGLLNGKSLSTAVSSAGNPASSVQTHHPFLNTLTTGSQFPLGPMALQANLNSVTNSSVL
QSLFNSMPAAASLVHVSSAATRLTNSHTMGNFSPGVTGGTVGGIFNHAVPSASSPHQFGA
SFSSSAVSSSTVLSLNPLQAVASTSSSSFPPPSSNLVTSSENRAAQHLNRAPVQSVFHPP
PPPPNVSLPPPPPLLASNPDLLHSPSIPPGDAFLPSSSAASVHSNTALSIKLASLQHKAS
RPSFTVHHPPLPRSALAQSVPPMAQPTAAGAPAMWVTLGMQPPSASHLSGVKPR
NT seq 5205 nt NT seq  +upstreamnt  +downstreamnt
atgggcgagcggctggagctgcgcctcaagtcgccggtgggagccgagcccgccgtgtac
ccgtggccgctgcccgtctacgacaaacaccatgatgctgctcatgaaatcattgagaca
attcggtgggtctgtgaagaaatcccagatctcaagcttgctatggaaaactacgttcta
attgactatgacacaaaaagctttgaaagcatgcagcggctgtgtgacaagtacaaccgc
gccatcgacagcatccatcagctgtggaagggaaccacccaaccgatgaagctgaacact
cgtccctccaacgggctcctccggcacatcctgcagcaggtttacaaccactcggtgacc
gaccccgagaaactcaacaactacgagcccttctcccctgaggtgtatggagaaacctcc
ttcgacctggtggcccagatgatagatgagattaaaatgacagaggacgacctctttgtc
gacttgggcagcggtgtgggtcaggtggtgcttcaagtggccgcagccacgaactgcaaa
catcactatggtgtggagaaagctgacattccagccaaatacgctgagacgatggacaga
gagttcagaaagtggatgaaatggtatgggaaaaaacatgcagaatacacactggaaaga
ggtgacttcctctcagaagaatggagagagagaattgcaaacacaagtgttatttttgtg
aataattttgcctttggtcctgaggtggatcaccaactgaaggagcgatttgccaacatg
aaggaaggtgggagaattgtgtcctcaaaaccttttgcacctctgaatttcagaattaac
agtcgaaacttgagtgatattggcactataatgagagtcgtggagctgtcaccactgaaa
ggctctgtgtcgtggactgggaagccagtctcttactacctgcatactattgaccgaacc
atacttgaaaactatttttctagtctcaaaaatccaaaactcagggaggaacaagaggca
gctagacgtcgtcagcagcgagaaaacaagagcaacacgactactccaacgaaggttcaa
gaaaacaaggattctggtgctgaagaagaaaaagctggggcaaatgctgttaaaaagcca
tctccctctaaagcaaggaagaaaaaactgagcaaaaaaggaaggaaaatggcaggcagg
aagcgagggcgtcccaagaaaatgaacactgcaaatacggagcgcaagaccaagaagaac
caaactgcactagaacttctgcatgctcaaactgtgtcacagacatcttcatcctctcct
caggatgcatacaagtcacctcatagtccatattaccaactacctcctaaagtgcaacgg
cattcatccaaccagctgctggtgacacccaccccacctgcactacagaagctgctagac
tcttttaagatccagtacatgcagttcatggcgtacatgaaaactcctcaatataaagca
agtctgcaacagttgctggagcaggagaaggagaagaatgcacagctactggggacggcg
cagcagttgttcacccactgccaggcacagaaagaggaaatcaaacgtctttttcagcag
aaactcgatgagttgggagtgaaggctctgacatacaacgacctgattcaggctcagaag
gaaatctctgctcacaatcagcagctgaaagaacagaccaaacagctggagaaggataac
agcgaactcaggaaccagagcctgcagctgctgaaggcacgctgcgaagagctgaagcta
gattggtccacgctgtcactggagaacttgctgaaggagaagcaggctctgaagaatcag
atttctgagaaacaaaagcactgtttggaactgcagatcagcattgtggaacttgagaaa
agccaaaggcagcaggagctcatgcagctgaaatcgtacacgccgtcggatgagtcactg
tcagtgcagctacggaataaaacccacctgagccgcgatgctgaggctgatcatggcagg
ttccagctggagctcgagtgctccaagtttcctatgccccacgtcaatggcttgagcccc
gaactgtccatgaatggccacgctactccctatgagattcacaacactttcagcaggccg
tcctccaagcagaacacccctcagtacatgacctctcatctggaccaagaaatagttcca
tgtaccccaaaccacagcaggcagaaggcggacaggatggcgagcctgtccttacctgat
tataccaggttttcccctgcgaaaatagcactaaggagacacttgaatcaagaccacaca
gtcaatggaaaagcaacaacgagtgagatacagagagctgaccacgtcaaagagaacggc
cttacatatccaagccccagtatttccaatggcatcaagctgagtcctcaggaaactcgg
ccctcttccccagcggccttaccgattgcaggcgagaaggttttgagagagagaacctct
gtgagtaatggagaaactatcaccagcctacccatcagtattcctctcagcacagtgcag
cccaataagctccctgttagcatccctctggccagcgtagttctgcctagccgtgttgag
aaggtgagaagcacacctagcccagttcatcagagcagagactcatcgacacttgaaaag
cagattggtgctagttctcataatggtgtaagcaatgctgctggaaacaagccactggct
ttggctacctcaggtttttcttactcttctggctccgtggcagtcaatggaaatcttaca
aacagcccagcccatcttaaccatagtgttgatcaggcagctctggacgactctgggagt
ctgtttaactcagtagggtctcggagttccactccacaacatcctttgctaatgatgcag
tcgaggaactctgggcaaagctcccctgctcaccagcactcagcaagccccaggttaaat
ggcacctcccagagcctggtagggggactgcactatgcagatgctcagaagatgtttgcc
gaaggaacaaagggggatcttcagtctgatgcagcattttcagatcctgagaacgaggcc
aagagaagaatcatctttacaatctctcctaatacaggacatgtaaaacaatccccttcc
accaagcacagccctctgcccgcgagcgctcggctggactgcggcccagcacacgggcag
gacgggaagaagcgcggccggcggaagagatcctccactgggaacctcagcgggggctcc
ggggtctcccccaaacgcaaatccttgcccgctgtgtccggactctttacgcagccatca
ggttcaccgctcaatatcaactccatggtcaataacattaaccagcctttagaaataaca
gccatttcctctcctgaaaactccctgaagaactctcctgttccttaccaggacaacgac
cagcccccggtactgaaaaaggaaaagcccctcactcagagcaacggcgttcattactcc
cctctcacgtcagatgacgagcagggatctgaagatgagcacaacagcaccaggatcgag
aggaaaattgcaacgatatcgctggaaagcaaatctccacagaagactgttgaaaatggt
ggcagcttatctgggaggaaacaagcacaacccaacgagaacatgaacagcagcaaatgg
aaatctactttctcaccaatatctgacatcaacctgaccaaaaccacggacagtcccttg
cagtctgtgtcgtctctgagccagaattcgctgtttgccttcaggccgtcctctgaggac
agcctcgccatggatgccaagatggcacacgcaaggaaaggcatggccatgccctcgtcg
ggggcagacgggctcagccccagcacaaaccccaccaacgggttcgcctacaacggtggg
ctgtcgactgacattggtttacacagctttatcgatggtgcttctcttccacacaaggcc
tcggacgggacggccgctgcctgctctctggggttccagtcgcagcggagcaaagatgtg
gggatatcggaaacaaaccctttcttgaacaagaggcaactcgaaggcctcggcggcgcc
aagggagaagacctcagccgggcaggagtcaaaagcaaagacatgagtgaaatgagcatt
cgtgcggggggttcttcagagaaaaactctttgcagcataacggaaaggtcggcaaagga
agggaccgagatgtggagttcaaaaacggccataaccttttcatttctgctgctgtttca
tctggtggccttctgaatgggaaaagcctttctactgctgtttcttcagcaggcaaccca
gcatcgtctgtgcagacgcaccatcccttcctcaacactttgaccactggatcgcagttc
cccctcggccccatggccttgcaagccaacctcaactcggtgacaaactcctcagtattg
cagtccttatttaattccatgccagctgctgccagtctggtccacgtgtcgtcagctgca
accagactgactaattctcacactatggggaacttctctcctggggttacaggtggaaca
gttggaggtatttttaaccatgcggtgccttctgcctcctctcctcatcagtttggagcc
agtttcagcagcagtgctgtctctagcagcacagtgctaagcttaaaccccctgcaggct
gttgccagcacctcgtcctcatccttcccacccccctcctctaatttagtaacatctagc
gagaatagagccgctcagcacctcaacagagcgccagtgcaatctgttttccatcctcct
ccgccccctcctaacgtttccttgcccccacccccccctctgctcgcttctaaccccgac
ctcctgcacagcccatccatcccacccggcgacgctttcctgccatcctcttccgccgct
tctgtccactctaacaccgctttgtctatcaagctcgcttccctgcagcacaaagcctcc
cgcccctcctttaccgtccaccacccccccctgccccgctcggcgctggcacagtccgtg
cccccgatggcgcagcccacggccgccggcgcgcccgccatgtgggtcacgcttggcatg
cagcctccttccgcttcgcacctttctggggttaagccgcgataa

DBGET integrated database retrieval system