KEGG   Gallus gallus (chicken): 427752Help
Entry
427752            CDS       T01006                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin G/H synthase 1 isoform X2
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
gga  Gallus gallus (chicken)
Pathway
gga00590  Arachidonic acid metabolism
gga01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gga00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    427752 (PTGS1)
Enzymes [BR:gga01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     427752 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF hEGF
Motif
Other DBs
NCBI-GeneID: 427752
NCBI-ProteinID: XP_015135064
CGNC: 898
Ensembl: ENSGALG00000001314
LinkDB All DBs
Position
17
AA seq 587 aa AA seqDB search
MDWDHSVPPPQPHWPVNPCCYYPCQHQGVCVRVGLEGYECDCTRTGYFGANCTSPELWTR
LRDLLKPSPTFYHFVLTHFRWFWDIINSTFIRDTLMRLVLTVRANLIPSPPTFNSQYGYI
SWEAYANVSYYTRILPPVPEECPTPMGTKGKQQLPDAQLLAQRFLLRHKFEADPRGTNLM
FAFFAQHFTHQFFKTSGKMGRGFTKALGHGVDLGHLYGDNLQRQHQLRLFQDGKLKFQVV
NGEVYPPSVTEVPVHMVYPPAIPKEKQLAMGQEVFGLLPGLCMYATLWLREHNRVCDILK
QEHPTWGDEQLFQTARLILIGETIKIVIEDYVQHLSGYFLNLKFDPELLFEQQFQYRNRI
AVEFNQLYHWHALMPDSFTIQGQEYSYEQFLYNTSMLMDYGVEALAESFSMQTAGRIGGG
QNINANVLGVAVGVIEESRQLRLQPFNEYRKRFGLKPYTSFQELTGEEDKAAELEELYGD
IDALEFYPGLLLEKPQPNGIFGESMVEIGAPFSLKGLLGNPICSPEYWKPSTFGGATGFE
IVKTASLEKLVCLNVKKCPYVAFHVPDAAAAGETDSGHAGGASSTEL
NT seq 1764 nt NT seq  +upstreamnt  +downstreamnt
atggactgggaccacagtgtgcccccaccacagccgcactggccggttaacccgtgctgc
tattatccctgccagcaccaaggcgtgtgtgtgcgggtcggcctggaaggctatgagtgc
gactgcacgcggacgggatacttcggggccaactgcacctcacctgagctctggacgcgc
ctacgtgacctgctgaagcccagtcccaccttctaccactttgtcctcacccacttcagg
tggttctgggacatcatcaacagcacattcatcagagacacgctgatgaggctcgtgctc
acagttcgcgccaacctcatccccagccctcccaccttcaactcccagtacggctacatc
agctgggaggcctacgccaatgtcagttattacacccgcatcctcccgccggtgccggag
gagtgccccacacccatggggaccaaagggaagcagcagctccccgatgcccagctgctg
gctcagcgcttcctgctgcggcacaaatttgaagctgaccccaggggcaccaacttgatg
tttgccttcttcgctcagcatttcacccaccagttcttcaagacctccgggaagatggga
cgtggtttcaccaaggcgctggggcacggggtggacctggggcacctgtatggggacaac
ctgcagcggcagcaccagctgcggctcttccaagatgggaagctcaaatttcaggtggtg
aacggggaggtgtacccaccgtccgtcaccgaggtgccggtgcacatggtctacccaccc
gccatccccaaggagaagcagctggcaatggggcaggaggtgttcgggctgctgccaggg
ctctgcatgtatgccacgctctggctgcgtgagcacaaccgtgtctgtgacattctgaag
caggagcatcccacctggggcgacgagcagctcttccagacagcgcggctcatcctcatc
ggggagaccatcaagatcgtcattgaggactacgtccagcacctcagtgggtacttcttg
aacctcaagttcgaccctgagctgctgttcgagcagcagttccagtaccggaatcgcatt
gcggtggagttcaaccagctctaccactggcacgcgctgatgcccgactccttcaccatc
cagggacaggagtacagctacgagcagttcctctacaacacctccatgctcatggactat
ggcgtggaggccctggcggagtccttttccatgcagactgcaggaaggatcggtgggggg
caaaacattaatgccaacgtactgggagtggctgttggagtcattgaggagtcgaggcag
ctgaggctgcagcccttcaatgagtaccggaagaggtttggcctgaagccctacacgtcc
ttccaggagctcacaggagaggaggacaaggcagcagagctggaggagctgtatggagac
atcgacgctctggagttttatccaggattgctgcttgagaaaccccaacccaacggcatc
tttggggaaagcatggtggagattggcgctccattttcactgaagggacttcttgggaac
cccatctgctccccagagtactggaagcccagtacctttggtggagcaaccggcttcgag
atcgtcaagacagcatccctggagaaactcgtgtgcctcaacgtgaagaagtgtccgtac
gtggcgttccatgtgccggatgctgcagcagcaggtgagactgacagcggccatgcaggt
ggagcatcatccacagagctgtag

DBGET integrated database retrieval system