KEGG   Grimontia hollisae: AL542_01975Help
Entry
AL542_01975       CDS       T04260                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
gho  Grimontia hollisae
Pathway
gho00473  D-Alanine metabolism
gho00550  Peptidoglycan biosynthesis
gho01100  Metabolic pathways
gho01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:gho00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    AL542_01975
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    AL542_01975
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    AL542_01975
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:gho01011]
    AL542_01975
Enzymes [BR:gho01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     AL542_01975
Peptidoglycan biosynthesis and degradation proteins [BR:gho01011]
 Precursor biosynthesis
  Amino acid ligase
   AL542_01975
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N ATP-grasp CPSase_L_D2 ATPgrasp_ST
Motif
Other DBs
NCBI-ProteinID: AMG29235
UniProt: A0A377JAA0
LinkDB All DBs
Position
2:437305..438303
Genome map
AA seq 332 aa AA seqDB search
MNPTKVLLLCGGGSAEHEVSLVSANYLESELNKLPSVSVIRVEITKNDGWKDSKGQDCRL
NLDKTLKVGDEIINIDFAVPCIHGFPGETGDIQSLFELAGVPYMGCDSSASNVCFNKITS
KLWFDAIGIPNTPYVFLTDNNEDSVRSAEDAFDRWGAIFVKAACQGSSVGCYKVTEKSAV
REAVASAFGYSNQVLVEKAVRPRELEIAAYHYNGEVVVTRPGEIACPEDTFYTYEEKYSA
GSHSQTTVEPENLTEEQIAQMREYAEKAFVHLKLKDLSRIDFFLTPEGDVLLNEINTFPG
MTPISMFPKLVEHNGHTFSEYLESCIRAGIAN
NT seq 999 nt NT seq  +upstreamnt  +downstreamnt
atgaacccaactaaagtattgttgttgtgtggtggcggtagtgctgagcatgaagtttca
ttggtatcagcaaattatctggaatctgagttaaataagctgccgtctgtctcggttatc
cgtgttgaaatcactaaaaacgatggctggaaagacagcaaagggcaagactgccgcctg
aacctggataaaactctcaaggtcggcgatgagattatcaatatcgactttgctgtgcct
tgcattcacggttttcccggtgaaaccggtgatattcaatctttatttgagctggcaggc
gtgccttatatggggtgtgattcgtcggcaagcaatgtttgttttaacaagatcacgtca
aagctttggtttgatgctatcggcattccaaacacaccgtatgttttccttacggataac
aacgaagacagtgttcgcagtgcagaggatgcttttgatcgctggggcgcaatttttgtc
aaagcggcgtgtcagggctcgtcggttggttgctataaagttactgagaaatctgcggtg
cgcgaagcggttgccagtgcattcgggtattcaaaccaggtgttggttgagaaagctgtt
cgtccacgagagctggaaattgctgcttatcattacaatggtgaagtggttgttacccga
ccaggcgaaattgcctgtccggaagataccttctacacctatgaagagaaatacagcgcc
ggtagtcatagccaaacgactgttgaaccagaaaacttgacagaagagcagatagcccaa
atgcgggaatacgcagaaaaagcgtttgtgcatttgaaactaaaagatctgtcgcgtatc
gatttcttcctgacaccagaaggcgatgtgctgctgaatgaaatcaataccttccctggt
atgacaccgatttctatgttcccaaaactggtcgaacacaacggccatacgttttcggag
tatctggaaagctgtatccgcgcaggtatcgccaactag

DBGET integrated database retrieval system