KEGG   Gekko japonicus: 107109747Help
Entry
107109747         CDS       T04299                                 

Gene name
LIG1
Definition
(RefSeq) DNA ligase 1
  KO
K10747  DNA ligase 1 [EC:6.5.1.1 6.5.1.6 6.5.1.7]
Organism
gja  Gekko japonicus
Pathway
gja03030  DNA replication
gja03410  Base excision repair
gja03420  Nucleotide excision repair
gja03430  Mismatch repair
Brite
KEGG Orthology (KO) [BR:gja00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    107109747 (LIG1)
   03410 Base excision repair
    107109747 (LIG1)
   03420 Nucleotide excision repair
    107109747 (LIG1)
   03430 Mismatch repair
    107109747 (LIG1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:gja03032]
    107109747 (LIG1)
   03400 DNA repair and recombination proteins [BR:gja03400]
    107109747 (LIG1)
Enzymes [BR:gja01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     107109747 (LIG1)
    6.5.1.6  DNA ligase (ATP or NAD+)
     107109747 (LIG1)
    6.5.1.7  DNA ligase (ATP, ADP or GTP)
     107109747 (LIG1)
DNA replication proteins [BR:gja03032]
 Eukaryotic Type
  DNA Replication Elongation Factors
   Other elongation factors
    107109747 (LIG1)
 Prokaryotic Type
   Elongation factors (archaeal)
    Other elongation factors
     107109747 (LIG1)
DNA repair and recombination proteins [BR:gja03400]
 Eukaryotic Type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    Long Patch-BER factors
     107109747 (LIG1)
   NER (nucleotide excision repair)
    Other NER factors
     107109747 (LIG1)
   MMR (mismatch exicision repair)
    Other MMR factors
     107109747 (LIG1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DNA_ligase_A_M DNA_ligase_A_N DNA_ligase_A_C RNA_ligase
Motif
Other DBs
NCBI-GeneID: 107109747
NCBI-ProteinID: XP_015265915
LinkDB All DBs
Position
Un
AA seq 926 aa AA seqDB search
MQSTIRSFFQPLAQIKPGKETAENKQPEDKLTPKKEPKNSDQLVNGTTLHEDSSEKCVAE
QATQNLNGGGEKDSGKPGGRDTKADDANQESDCAPEQKTPAENISPSTSPVASNSPSPSS
IPRRRTARKQLPKRKVEEDDGSQDITQKEMCAKKQKTDSAGEGSKEEPYEKPMEAEDMKE
EDAKIVEVKTEKEEEAEIAEAEEEKMLIPSKPSSKPISSFFAPRKASVKAEKKQTPAMGE
NMPAQRSHSEVSSHESGSAAASSLSPSPTIDPADYNPTKNNYHPLHDACWGPGQRVPYLA
VARTFERIEEESARLKIIETLSNLFRSVIALSPEDLLPCVYLCLNQLGPAYEGLELGIGK
TILMKALAQATGRQLDQIKAEAAEKGDLGLVAESSRTTQGTMFAPPKLGAAVVFGKLQAI
GRMTGSSSMNKKIDIIKSLFVACRYSEARYVARSLEGKLRIGLAEQSVLSALAQAASLTP
PGQKFPPMILDAAKGKSAEARKAWLEERALIVKQAYCELPNYDTLVPVLLEHGVENVPQH
CKITPGIPLRPMLAHPTKGIGEVLKRFDEAAFTCEYKYDGERAQIHILENGEVHIYSRNQ
ENNTSKYPDIVSRIPKVKKSTVQSCILDAEAVAWDPGSKQIQPFQVLTTRKRKDVDATEI
RVQVCVYAFDMLYLNGQSLVREPLAQRRTLLRDSFTEVEGQFLFATSMDTSNTDEIADFL
ECSIKDSCEGLMVKTLEVDATYEIAKRSHNWLKLKKDYLDGVGDTLDLVVIGAYLGNGKR
AGFYGGYLLACYDEESEEYQSICKIGTGFKDEVLEKLHASLKDHVIPQPRPYYRWGGTAE
PDHWLEAQKVWEVKCADLSISPVYKAATGLVDEEKGISLRFPRFLRIREDKKPEEATTSI
QVAELYRKQQQIQNQQSVEKGDGDFY
NT seq 2781 nt NT seq  +upstreamnt  +downstreamnt
atgcagagcacaatcagatcattcttccaacctctagcccaaataaagcctggaaaagag
acggcagagaataagcaaccagaagataagctgacccctaaaaaggaaccaaaaaattct
gaccagttggtgaatggtacgaccctccatgaagattcctcagagaaatgtgtagctgaa
caagccactcagaaccttaatggtggaggtgaaaaagattctgggaaaccaggaggaaga
gatacaaaggcagatgatgcaaaccaggaatcggactgtgctcctgagcaaaagacacct
gcagagaacatctccccaagcaccagcccagttgcctctaattcaccttcaccttccagc
attccccggcgcagaactgcccgcaagcagctccctaaacgtaaagtggaggaagatgat
ggcagtcaagacatcactcagaaggagatgtgtgccaaaaaacagaaaacagacagtgct
ggggaaggctcaaaagaggaaccatatgaaaagccaatggaagcagaagacatgaaagag
gaggatgctaagattgtggaggttaaaactgaaaaagaagaggaagcagaaatagcagaa
gcagaggaagagaagatgctaataccctccaagccatccagcaaacccatctctagtttt
tttgcccctagaaaagcttctgtgaaagcagagaaaaagcagacacctgcgatgggagaa
aacatgcctgcacaaaggagccacagtgaagtcagtagccatgagtctggcagtgcagct
gcaagttctctcagcccatctcccacaattgaccctgcagattataaccccacaaagaac
aactatcatcctctccatgatgcttgttggggtcctggccagagggtaccatatctggct
gtggcccgtacctttgagcggattgaagaagagtctgcccggctgaaaatcatagagact
ctgagcaatctgtttcgctctgtgattgctctgtctcctgaagacttgctgccctgtgtg
tacctctgcctcaatcagctaggcccagcgtatgagggcctagagttgggcattggcaaa
accatcctcatgaaagccttggctcaggccacaggtcggcagctggaccagatcaaggca
gaggcagcggagaagggggacctgggtttggttgcagagagtagccgcaccactcagggc
accatgtttgccccgcccaagcttggtgctgctgttgtctttggcaagttacaagcaatt
gggcgtatgacaggaagttcttccatgaacaagaagattgacattatcaagtccttgttt
gttgcttgtcgctactcagaggctcgctatgttgctcgatcactggaagggaagctgcgg
attgggctagcagaacagtctgtcctgtcagccctggcccaggcagcatcacttacacct
ccaggacagaaattccccccaatgattctggatgctgctaaggggaaatctgcagaggcg
cgcaaagcctggctagaggagagagccttgattgttaagcaagcctactgtgaactgcca
aattacgacacccttgtgcctgtcctcctagagcatggtgtggagaacgtgcctcagcac
tgcaagatcacaccagggatcccattgaggccgatgttggcccacccaaccaaaggcatt
ggggaagtcttaaagcgctttgatgaagcagctttcacctgtgaatacaagtatgatggg
gaacgggcacagatccacatcctggagaatggggaagtgcacatttacagcaggaaccaa
gagaacaacacatccaagtatcctgacattgtcagtcgtatccccaaggtgaaaaaaagc
actgtgcagtcatgcatcttggatgcagaggctgtggcctgggacccaggttcaaaacag
atccagcccttccaggtactgaccacccgcaagcgcaaggatgtggatgctacagagatc
cgagtgcaagtgtgtgtgtatgccttcgacatgctctacctcaatgggcagtcattggtc
cgggagcccctagcccagcgccgaactttgttgcgtgattccttcactgaggttgaaggc
cagttcctctttgccacctccatggatactagtaacaccgacgaaatagcagatttcctg
gagtgctccatcaaagactcatgtgaggggctgatggtgaaaacattggaagtggatgcc
acgtatgaaattgcaaagagatcccacaactggctgaagcttaaaaaagattacctggac
ggtgttggggacacactggacctggtggtgattggtgcctacctgggaaatggcaaacgt
gcaggcttctatggaggctacctcttggcttgctacgatgaggagagtgaggagtaccag
agcatctgtaagatcggcactggattcaaagatgaggtcctggagaaacttcatgcctcc
ctcaaggaccatgtgattccgcagccacgcccatactaccgctggggtggaacagctgaa
cctgaccattggctagaggcccaaaaagtctgggaggtgaaatgcgctgacttatccatt
tctcccgtttacaaggcagccactggtttggtggatgaggaaaagggaatttctctacgc
ttccctaggttcctccgtatccgggaggataagaaaccggaagaggccactaccagcatc
caggtggctgaactataccggaagcagcagcaaatccagaaccagcagtcagtggaaaaa
ggagatggcgatttttactag

DBGET integrated database retrieval system