KEGG   Gekko japonicus: 107116524Help
Entry
107116524         CDS       T04299                                 

Gene name
PTGS1
Definition
(RefSeq) prostaglandin-endoperoxide synthase 1
  KO
K00509  prostaglandin-endoperoxide synthase 1 [EC:1.14.99.1]
Organism
gja  Gekko japonicus
Pathway
gja00590  Arachidonic acid metabolism
gja01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:gja00001]
 09100 Metabolism
  09103 Lipid metabolism
   00590 Arachidonic acid metabolism
    107116524 (PTGS1)
Enzymes [BR:gja01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.99  Miscellaneous
    1.14.99.1  prostaglandin-endoperoxide synthase
     107116524 (PTGS1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: An_peroxidase EGF
Motif
Other DBs
NCBI-GeneID: 107116524
NCBI-ProteinID: XP_015273935
LinkDB All DBs
Position
Un
AA seq 600 aa AA seqDB search
MCWLCCTLPLVMLLSLSVSPGAPSTVNLCCSFPCQHKGICVQVGMEDYECDCTRTGYFGK
NCTLPEFWTRLRSALKPSPSFYHFILTHFRWFWDIINNTFIRDTLMRLVLTIRANLIPSP
PTYNSAYGYISWEAYANVSYFTRVLPPVPNDCPTPMGTKGPVRLPDAELVAERFFLRRTF
QPDPLGTNLMFAFFAQHFTHQFFKTSGKMGHGFTRALGHGVDLGHIYGDNLERQHKLRLF
QDGKLKYQMINGEMYPPTVLEAPVHMIYPKHIPLEQRLAVGQEVFGLLPGLMMYATIWLR
EHNRVCDILKKEHPTWDDEQLFQTTRLILIGETIKIVIEDYVQHLSNYYLRLKFDPELLF
GVQFQYRNRIAVEFNQLYHWHPLMPDSFAIKNKEYSYGQFVYNTTMLTDYGVDALVDAFS
RQRAGQVGGGRNIHSQLLHVAIGVIEESRLLRLQPFNEYRKRFGMKPYTSFQELTGEEEM
AAELEEVYGDIDAMEFYPGLLVEKRQPNAIFGESMVEIGAPFSLKGLLGNPICSPEYWKP
STFGGATGFEMVNTASLQKLVQRNVKNCSYVAFRVPEGDMEEMAEAAGSSSGEKTPSSEL
NT seq 1803 nt NT seq  +upstreamnt  +downstreamnt
atgtgctggctgtgctgcaccctccctttggtgatgctcctgagtctaagtgtgagcccc
ggagcccccagcacagtgaatctatgctgctctttcccatgccagcacaaaggcatatgt
gtccaagtgggcatggaagactacgaatgcgactgcaccaggactggctattttggcaag
aactgcactttgccggagttctggacgaggttgcgcagtgccctgaaaccaagccccagt
ttctatcacttcatcctgacccacttccggtggttctgggacatcatcaacaacacattc
atccgggacacactgatgcggttggtgctgacaatccgtgccaatctcattcccagcccg
cccacctacaattctgcctatgggtacatcagttgggaggcctatgccaacgtcagttac
ttcactcgtgtcctcccaccagtgcccaacgactgccccactcctatgggaaccaaaggg
ccagtgcggctccctgatgcagagctggtggcagagcggtttttcctgcgcaggacattc
cagcctgatcccctggggacaaacttgatgtttgctttctttgcccagcacttcacacac
cagttcttcaagacgtcgggcaagatgggtcatggtttcacccgggctctggggcatggg
gtggatcttgggcacatatatggggacaatttggagcgccagcacaaactcagactcttc
caggatgggaagctgaagtaccagatgattaacggggagatgtatccacctacggtgctg
gaagctccagtgcacatgatctatccaaagcacatccccctggagcagcgccttgctgtg
ggccaagaggtctttggcctcctaccaggcctcatgatgtacgccaccatctggctgcgg
gagcacaaccgcgtctgtgacatactgaagaaggaacacccaacctgggatgatgagcag
ctgttccagaccacaaggctcatcctcattggtgagaccatcaaaatagtaattgaagac
tatgtccaacatctcagcaactactacttgcgtctgaagttcgacccagagctccttttc
ggggtgcagttccagtatcggaaccgcattgctgtggaattcaaccagctctaccattgg
cacccgctgatgccagacagctttgccatcaagaacaaggagtacagctatggccagttt
gtctacaacacgaccatgctgacagattacggggtggatgctcttgtagatgctttctcc
agacagcgagctgggcaggttggaggggggaggaatatccacagtcagcttctgcatgtg
gccattggggtcattgaggaatcacgcctgctgcgcctccagcccttcaatgaataccgg
aagaggtttggcatgaaaccctacacgtccttccaggaactcacaggggaggaggagatg
gcagctgagctggaagaggtgtacggagacattgatgccatggaattctaccctggcttg
ctggtggagaagaggcagcccaatgccatttttggagaaagcatggtggaaattggggcc
cccttctccttgaaagggctcttggggaatcccatctgctctcctgagtactggaagccc
agtacatttggtggtgccactggctttgagatggtgaacacagcatcactccagaaactt
gtacagcggaatgtgaagaactgctcgtatgtggctttccgggtaccagaaggtgatatg
gaggaaatggcagaggcagcaggcagcagctctggagagaagacgccatcttctgagctt
tag

DBGET integrated database retrieval system