KEGG   Geobacillus kaustophilus: GK3007Help
Entry
GK3007            CDS       T00217                                 

Definition
(GenBank) acetyl-CoA acyltransferase
  KO
K00632  acetyl-CoA acyltransferase [EC:2.3.1.16]
Organism
gka  Geobacillus kaustophilus
Pathway
gka00071  Fatty acid degradation
gka00280  Valine, leucine and isoleucine degradation
gka00281  Geraniol degradation
gka00362  Benzoate degradation
gka00592  alpha-Linolenic acid metabolism
gka01100  Metabolic pathways
gka01110  Biosynthesis of secondary metabolites
gka01120  Microbial metabolism in diverse environments
gka01130  Biosynthesis of antibiotics
gka01212  Fatty acid metabolism
Module
gka_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:gka00001]
 09100 Metabolism
  09103 Lipid metabolism
   00071 Fatty acid degradation
    GK3007
   00592 alpha-Linolenic acid metabolism
    GK3007
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    GK3007
  09109 Metabolism of terpenoids and polyketides
   00281 Geraniol degradation
    GK3007
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    GK3007
   00642 Ethylbenzene degradation
    GK3007
Enzymes [BR:gka01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.16  acetyl-CoA C-acyltransferase
     GK3007
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAD77292
UniProt: Q5KVJ4
LinkDB All DBs
Position
complement(3030008..3031180)
Genome map
AA seq 390 aa AA seqDB search
MREAVIVAGARTPVGKAKKGTLAHVRPDDLGALVVKETIKRAGNYEGNIDDLIIGCAMPE
AEQGLNIARNIGALAGLPYTVPAITINRYCSSGLQAIAYAAERVMLGHSDTVIAGGVESM
SMVPMMGHVVRPNARLAEEAPEYYMSMGHTAEQVAKKYGVSREDQDAFAVRSHQRAAKAI
AEGKFNEEIVPVEVTVRKVEGNKLVEEKVVFTQDEGVRPDTNMETLAKLRPAFAVNGTVT
AGNASQMSDGAAAVMVMDREKAESLGLKPLGKFRSFAVAGVPPEVMGIGPVAAVPKALKL
AGLELSDIGLIELNEAFASQSIQVIRELGLDEDIVNVNGGAIALGHPLGCTGAKLTLSLL
YEMRRRNVQFGIVTMCIGGGMGAAGVFELL
NT seq 1173 nt NT seq  +upstreamnt  +downstreamnt
gtgagagaagcggtcattgtcgcaggtgcgcgcacaccggtcggcaaagcgaaaaaagga
acgctcgcccacgtgcggccggatgatttaggggcgctcgtcgtcaaagaaacgatcaag
cgcgcggggaactatgaaggaaacattgacgacttgattatcgggtgcgccatgccggag
gcggagcaaggattgaacatcgcccgcaacatcggcgcgctcgccgggctgccatatacc
gtgccggcgatcacgatcaaccggtattgctcgtccggtttgcaggcgatcgcctatgcg
gcggaacgggtgatgctcggccattccgacacggtcatcgccggcggggtcgaatcgatg
agcatggtgccgatgatggggcatgtcgtccgcccgaacgcccgcttggcggaagaagcg
ccggaatactacatgtcgatggggcacactgccgagcaagtggcgaaaaaatacggcgtc
agccgcgaggaccaagacgcattcgcggtgcgcagccaccagcgcgccgccaaggcgatt
gccgaaggaaaattcaatgaagaaatcgtgccggtcgaggtgacggtgcgcaaagtagaa
ggcaacaaactcgttgaggagaaagtcgtctttacacaagatgaaggcgtgcgcccggac
acgaatatggaaacgctcgcgaaactccggccggcgtttgcggtaaatggcaccgtcacc
gccggcaacgcgtcgcaaatgagcgacggggcggcggcggtcatggtgatggaccgcgaa
aaagcggagtcgctcggcttgaagccgctcggcaagtttcgttcgttcgcggttgccggc
gtgccgccggaagtgatggggatcggcccggtcgctgcggtgccgaaagcgttgaagctg
gccggccttgagctgtccgacatcggtttgatcgagctgaacgaagcgttcgcctcgcaa
tcgatccaagtcatccgcgaacttgggttggatgaagacattgtcaacgtcaacggcggg
gcgattgctctaggccacccgctcggctgcacgggcgcgaagctgaccttgtctttgctt
tacgaaatgcggcgccgcaacgtgcagttcggcatcgtcacgatgtgcatcggcggcggc
atgggagcggccggcgtgtttgagctgctgtag

DBGET integrated database retrieval system