KEGG   Geobacillus lituanicus: GLN3_06530Help
Entry
GLN3_06530        CDS       T05193                                 

Definition
(GenBank) 6-phosphofructokinase
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
gli  Geobacillus lituanicus
Pathway
gli00010  Glycolysis / Gluconeogenesis
gli00030  Pentose phosphate pathway
gli00051  Fructose and mannose metabolism
gli00052  Galactose metabolism
gli00680  Methane metabolism
gli01100  Metabolic pathways
gli01110  Biosynthesis of secondary metabolites
gli01120  Microbial metabolism in diverse environments
gli01130  Biosynthesis of antibiotics
gli01200  Carbon metabolism
gli01230  Biosynthesis of amino acids
gli03018  RNA degradation
Module
gli_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
gli_M00345  Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:gli00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    GLN3_06530
   00030 Pentose phosphate pathway
    GLN3_06530
   00051 Fructose and mannose metabolism
    GLN3_06530
   00052 Galactose metabolism
    GLN3_06530
  09102 Energy metabolism
   00680 Methane metabolism
    GLN3_06530
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    GLN3_06530
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatases and associated proteins [BR:gli01009]
    GLN3_06530
  09182 Protein families: genetic information processing
   03019 Messenger RNA biogenesis [BR:gli03019]
    GLN3_06530
Enzymes [BR:gli01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     GLN3_06530
Protein phosphatases and associated proteins [BR:gli01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     GLN3_06530
Messenger RNA biogenesis [BR:gli03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     GLN3_06530
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK NAD_kinase PucR Peripla_BP_1
Motif
Other DBs
NCBI-ProteinID: ASS86812
UniProt: A0A223DUZ5
LinkDB All DBs
Position
complement(1303590..1304549)
Genome map
AA seq 319 aa AA seqDB search
MKRIGVLTSGGDSPGMNAAIRSVVRKAIYHGVEVYGVYHGYAGLIAGNIKKLEVGDVGDI
IHRGGTILYTARCPEFKTEEGQKKGIEQLKKHGIEGLVVIGGDGSYQGAKKLTEHGFPCV
GVPGTIDNDIPGTDFTIGFDTALNTVIDAIDKIRDTATSHERTYVIEVMGRHAGDIALWS
GLAGGAETILIPEADYDMNDVIARLKRGHERGKKHSIIIVAEGVGSGVDFGRQIQEATGF
ETRVTVLGHVQRGGSPTAFDRVLASRLGARAVELLLEGKGGRCVGIQNNQLVDHDIAEAL
ANKHTIDQRMYALSKELSI
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
gtgaaacgcattggtgtgttgacaagcggcggcgactcgccgggaatgaatgcggccatt
cgctcggttgtccgcaaagcgatttaccacggtgtggaagtgtacggcgtttatcacggg
tatgccggactgatcgccggcaacattaaaaagctggaagtcggcgatgtcggggatatt
atccaccgtggcggcacgatactctatacggcccgctgtccggaatttaagacggaagaa
ggtcagaaaaaagggatcgagcagctgaaaaagcacggcattgaagggctggtcgtcatc
ggcggcgacggttcgtaccaaggggcgaaaaaactgaccgagcacggctttccgtgcgtc
ggcgtgccggggacgattgacaacgacattccgggcactgattttacgatcgggtttgac
acggcgctcaatacggtcattgatgccatcgacaaaatccgcgacacggcgacgtcgcac
gagcggacgtacgtcatcgaagtgatgggccgccatgccggcgacatcgccttatggtcg
gggctggccggcggggcggaaacgattttaattccggaagccgattatgatatgaacgac
gtcatcgcccgcttaaagcgcggccatgagcgcggcaaaaaacatagtatcatcatcgtg
gcggaaggggttggaagcggcgtcgacttcggccggcaaatccaggaagcgaccggcttt
gagacgcgtgtgacggtgcttggccacgtgcagcgcggcgggtcgcccacggcgtttgac
cgagtgctcgcgagccgcctcggcgcccgggcggtcgagctgttgctcgaaggaaaaggc
gggcgctgcgtcggcatccaaaacaaccagctcgtcgaccatgacatcgcggaggcgctg
gccaacaaacatacgatcgatcagcggatgtacgcattgtcgaaagaattgtccatttaa

DBGET integrated database retrieval system