KEGG   Glycine max (soybean): 100801923
Entry
100801923         CDS       T01710                                 

Definition
(RefSeq) shikimate O-hydroxycinnamoyltransferase
  KO
K13065  shikimate O-hydroxycinnamoyltransferase [EC:2.3.1.133]
Organism
gmx  Glycine max (soybean)
Pathway
gmx00940  Phenylpropanoid biosynthesis
gmx00941  Flavonoid biosynthesis
gmx00945  Stilbenoid, diarylheptanoid and gingerol biosynthesis
gmx01100  Metabolic pathways
gmx01110  Biosynthesis of secondary metabolites
Module
gmx_M00039  Monolignol biosynthesis, phenylalanine/tyrosine => monolignol
Brite
KEGG Orthology (KO) [BR:gmx00001]
 09100 Metabolism
  09110 Biosynthesis of other secondary metabolites
   00940 Phenylpropanoid biosynthesis
    100801923
   00945 Stilbenoid, diarylheptanoid and gingerol biosynthesis
    100801923
   00941 Flavonoid biosynthesis
    100801923
Enzymes [BR:gmx01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.133  shikimate O-hydroxycinnamoyltransferase
     100801923
SSDB
Motif
Pfam: Transferase
Other DBs
NCBI-GeneID: 100801923
NCBI-ProteinID: XP_003543709
UniProt: A0A0R4J520
LinkDB
Position
13
AA seq 439 aa
MLINVKQSTMVRPAEETPRRALWNSNVDLVVPNFHTPSVYFYRPNGVSNFFDAKVMKEAL
SKVLVPFYPMAARLRRDDDGRVEIYCDAQGVLFVEAETTAAIEDFGDFSPTLELRQLIPS
VDYSAGIHSYPLLVLQVTYFKCGGVSLGVGMQHHVADGASGLHFINAWSDVARGLDISLP
PFIDRTLLRARDPPLPVFDHIEYKPPPATKKTTPLQPSKPLGSDSTAVAVSTFKLTRDQL
STLKGKSREDGNTISYSSYEMLAGHVWRSVCKARALPDDQETKLYIATDGRARLQPPLPH
GYFGNVIFTTTRIAVAGDLMSKPTWYAASRIHDALIRMDNEYLRSALDYLELQPDLKSLV
RGAHTFRCPNLGITSWARLPIHDADFGWGRPIFMGPGGIAYEGLSFIIPSSTNDGSLSLA
IALPPEQMKVFQELFYDDI
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgttgatcaatgtgaagcaatccaccatggttcggccggcggaggagacgccgcggagg
gcgttgtggaactccaacgtggatttggtggtgccgaacttccacacgccgagcgtgtat
ttctacaggccaaacggggtctccaatttcttcgacgccaaggtgatgaaggaggctctg
agcaaggtcttggtccctttctacccaatggccgcacgcctccgccgggacgacgacggg
cgcgtggagatatactgcgacgctcagggcgtgctcttcgtggaggctgagaccactgcc
gccatcgaggacttcggcgacttctctcccaccctggagctccggcagctcatcccctcc
gtggattattctgccggtatccactcctatccgctgttggtgctacaggtaacatatttc
aaatgtggaggggtctcattaggtgttggtatgcaacaccatgtagcagacggagcatct
ggtcttcactttatcaatgcatggtcagatgttgctcgtggcttggatatttccctcccc
ccattcattgacaggacactactccgtgcccgggatccacctcttcctgtttttgatcac
attgaatacaagcccccaccagccactaagaagactactcccctgcaaccctcaaaacca
ttaggctctgacagtactgctgttgccgtctctactttcaaattgacccgtgaccaactg
agcaccctcaagggtaagtccagagaagatggcaacacaatcagctacagctcttatgag
atgttggctggccatgtatggagaagtgtctgtaaggcaagagcacttcctgatgaccaa
gaaaccaaattgtacattgcaaccgatggacgggcgaggctgcaacctcccctcccccat
ggttactttggcaatgtcatcttcaccaccactcgcatagcagtggctggtgatctcatg
tcaaaaccaacatggtatgctgctagcagaatccacgacgcattaatacgaatggacaat
gaatatttgagatcggctcttgactatctagagctgcagcctgatctaaaatcccttgtt
cgtggagcacatacttttagatgtccaaatcttggtatcactagctgggcaaggcttcca
atccatgatgctgactttggttggggaagacccattttcatgggacctggtgggattgca
tacgaggggctatctttcataatcccaagctcaacaaatgatgggagcctgtcgttggca
attgctctgccgcctgagcaaatgaaagtgtttcaggaattgttttatgatgacatttga

DBGET integrated database retrieval system